DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sas and Ccn4

DIOPT Version :9

Sequence 1:NP_001262337.1 Gene:sas / 40861 FlyBaseID:FBgn0002306 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_061353.1 Gene:Ccn4 / 22402 MGIID:1197008 Length:367 Species:Mus musculus


Alignment Length:378 Identity:77/378 - (20%)
Similarity:107/378 - (28%) Gaps:119/378 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   618 APSTNGTGESAVTLPTTDDEATPKPRTDCHYNSGVYKFRERLEIGCEQICHCAEGGVMDCRPRCP 682
            |.:.:.|..:....|...:|.|.:|..                  |:..|.|.:.     .||||
Mouse    22 ATALSPTPTTMTFTPAPLEETTTRPEF------------------CKWPCECPQS-----PPRCP 63

  Fly   683 ERNHTRLDKCVYVKDPKDVCCQLELCDVTLDDHEQQPTPLQSNNNEDPEEIDPFRFQEQARDAGG 747
            .......|.|        .||  ::|...|.|           |..:....||.|  ....|..|
Mouse    64 LGVSLITDGC--------ECC--KICAQQLGD-----------NCTEAAICDPHR--GLYCDYSG 105

  Fly   748 AKPT-------------CTFKGAEYDVGQQFRDGCDQLCICNEQGIHCAKLECPSNFGLDVQDPH 799
            .:|.             |...|..|..|:.|:..|...|.|.:..:.|.              |.
Mouse   106 DRPRYAIGVCAQVVGVGCVLDGVRYTNGESFQPNCRYNCTCIDGTVGCT--------------PL 156

  Fly   800 CIRWEPVPADFKPSPPNC-CPESMRCVDNGTCSYQGVQIENWSPVPANLTGCDQHCYCENGRVE- 862
            |:         .|.||.. |.:.......|.|..|.| .::.:..|......|...:..:|.|| 
Mouse   157 CL---------SPRPPRLWCRQPRHVRVPGQCCEQWV-CDDDARRPRQTALLDTRAFAASGAVEQ 211

  Fly   863 ----CRAACPPVPALPPADLPCHPAL--------ARLLPIPDDECCKHWMCAPQIPKIGGAG--- 912
                |.|...|   ..|....|...:        ||..|..:...|....|...|.....||   
Mouse   212 RYENCIAYTSP---WSPCSTTCGLGISTRISNVNARCWPEQESRLCNLRPCDVDIQLHIKAGKKC 273

  Fly   913 ----QDEETEATSTHSSIPANETTTT-------TATANKSTSIPSKVPQIKKD 954
                |.||    :|:.::....:|.|       ..|.|: ..||.|...|..|
Mouse   274 LAVYQPEE----ATNFTLAGCVSTRTYRPKYCGVCTDNR-CCIPYKSKTISVD 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sasNP_001262337.1 VWC 752..824 CDD:214564 15/72 (21%)
fn3 1413..1479 CDD:278470
FN3 1516..1605 CDD:238020
Ccn4NP_061353.1 IGFBP 49..101 CDD:278641 18/79 (23%)
VWC 123..181 CDD:214564 17/80 (21%)
TSP_1 220..259 CDD:301595 7/41 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11348
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.