DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sas and CCN2

DIOPT Version :9

Sequence 1:NP_001262337.1 Gene:sas / 40861 FlyBaseID:FBgn0002306 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_001892.2 Gene:CCN2 / 1490 HGNCID:2500 Length:349 Species:Homo sapiens


Alignment Length:412 Identity:85/412 - (20%)
Similarity:120/412 - (29%) Gaps:168/412 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   549 RDCDERCTCNRGDWMCEPRCRGLSYPRGSQRSMANPNCLEKMVEEDECCRVMECSEPQLEPTVVA 613
            ::|...|.|....   .|||     |.|.  |:....|        .||||  |:: ||      
Human    27 QNCSGPCRCPDEP---APRC-----PAGV--SLVLDGC--------GCCRV--CAK-QL------ 64

  Fly   614 TEGAAPSTNGTGESAVTLPTTDDEATPKPRTDCHYNS---------------------GVYKFRE 657
                       ||    |.|..|...|.....||:.|                     .||:..|
Human    65 -----------GE----LCTERDPCDPHKGLFCHFGSPANRKIGVCTAKDGAPCIFGGTVYRSGE 114

  Fly   658 RLEIGCEQICHCAEGGV-------MDCR---PRCPERNHTRLDKCVYVKDPKDVCCQLELCDVTL 712
            ..:..|:..|.|.:|.|       ||.|   |.||.....:|         ...||:..:||   
Human   115 SFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKL---------PGKCCEEWVCD--- 167

  Fly   713 DDHEQQPTPLQSNNNEDPEEIDPFRFQEQARDAGGAKPT-----CTFKGAEYDVGQQFRDGCDQL 772
                 :|        :|...:.|.....:..|..|..||     |..:..|:       ..|.:.
Human   168 -----EP--------KDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEW-------SACSKT 212

  Fly   773 CICNEQGIHCAKLECPSNFGLDVQDPHCIRWEPVPADFKPSPPNCCPESMRCVDNGTCSYQGVQI 837
            |   ..||........::..|:.|...|: ..|..||.:.:    ..:..:|:.....|      
Human   213 C---GMGISTRVTNDNASCRLEKQSRLCM-VRPCEADLEEN----IKKGKKCIRTPKIS------ 263

  Fly   838 ENWSPVPANLTGCD-------QHC-YCENGRVECRAACPPVPALPPADLPCHPALARLLPI---- 890
               .|:...|:||.       :.| .|.:||      |            |.|.....||:    
Human   264 ---KPIKFELSGCTSMKTYRAKFCGVCTDGR------C------------CTPHRTTTLPVEFKC 307

  Fly   891 PDDE-----------CCKHWMC 901
            ||.|           |..|:.|
Human   308 PDGEVMKKNMMFIKTCACHYNC 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sasNP_001262337.1 VWC 752..824 CDD:214564 12/71 (17%)
fn3 1413..1479 CDD:278470
FN3 1516..1605 CDD:238020
CCN2NP_001892.2 IGFBP 29..82 CDD:395164 23/94 (24%)
VWC 103..163 CDD:278520 17/68 (25%)
TSP1_CCN 199..242 CDD:408805 9/53 (17%)
Heparin-binding. /evidence=ECO:0000269|PubMed:12553878 247..349 21/114 (18%)
GHB_like 253..345 CDD:419725 21/104 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11348
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.