DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sas and AgaP_AGAP013206

DIOPT Version :9

Sequence 1:NP_001262337.1 Gene:sas / 40861 FlyBaseID:FBgn0002306 Length:1693 Species:Drosophila melanogaster
Sequence 2:XP_003436164.1 Gene:AgaP_AGAP013206 / 11175859 VectorBaseID:AGAP013206 Length:305 Species:Anopheles gambiae


Alignment Length:297 Identity:71/297 - (23%)
Similarity:110/297 - (37%) Gaps:89/297 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 MCLATLCGLLLLGIQIERAASAP----AGED----AAATTM-----PPLDTTTDAP-DAVAATTT 71
            :..||:| |:.....:.:.|.||    ||.|    ||.:|:     |...||..:| :.:...|.
Mosquito    11 LAAATVC-LMFCWPALAQDAEAPTATSAGSDELAPAATSTIVNTIEPSEPTTAGSPLEVLPLATN 74

  Fly    72 PATTAAEQSSSISSITTEAADGSTTSTTTTTEAANKSNATETDFTTNVPVASSLPEETSVR---- 132
            |.|  |:...||::......||    ||||.:||..::|..|:.||..|..|:.||..:|:    
Mosquito    75 PPT--ADSGESIATDQPAQVDG----TTTTQQAALDTSAPSTEGTTAQPDTSTPPEVKTVQEDAD 133

  Fly   133 ----STSIEPITSTEPTTTPRQETEGPDQHMVFSNTEPDQSHIQHIPLRDEHAESSGADDATTEM 193
                :|:|.|.|.::.:|.|             ......:..|.|:...:|.|.....|      
Mosquito   134 RTTTTTTIAPTTVSDVSTAP-------------PTVAAPKPVILHVKSPEEEANDRAGD------ 179

  Fly   194 QRQREQDQQQNELNQISNEQDDVVKDLNNFRHPATL---ITASNSNSEENVEIESDK-QVETTTT 254
                                          |.|:.|   :.:..|:|||.:::...: ..|....
Mosquito   180 ------------------------------RPPSILNHFLPSGESSSEELLKMSDVRASAEVRGR 214

  Fly   255 AV---PAA----ATSTSTEATGTPPTGTPATSTSTVP 284
            |:   ||.    .|:.:...|..||...||...||.|
Mosquito   215 AISFGPAEPINFVTAPNLVTTVPPPGRAPAADQSTKP 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sasNP_001262337.1 VWC 752..824 CDD:214564
fn3 1413..1479 CDD:278470
FN3 1516..1605 CDD:238020
AgaP_AGAP013206XP_003436164.1 PRK07994 <24..>173 CDD:236138 45/167 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016815
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.