DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sas and ccn4

DIOPT Version :9

Sequence 1:NP_001262337.1 Gene:sas / 40861 FlyBaseID:FBgn0002306 Length:1693 Species:Drosophila melanogaster
Sequence 2:XP_002939562.2 Gene:ccn4 / 100492186 XenbaseID:XB-GENE-484776 Length:358 Species:Xenopus tropicalis


Alignment Length:358 Identity:75/358 - (20%)
Similarity:113/358 - (31%) Gaps:105/358 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   480 LMDLSDVSMDGDQNEGSSKTESSTTST------TTTTAQPETEMPKIVEITASGDTMQRECLANN 538
            |.|..|......:..|.:.||:.|..|      ..:...|..|:....::|..|      |:.|.
 Frog    61 LTDGCDCCKTCAKQRGENCTEADTCDTHKGLYCDYSGDSPRYEVGVCGQMTGVG------CVLNG 119

  Fly   539 KSYKHGELMERDCDERCTCNRGDWMCEPRCRG----LSYPRGSQRSMANPNCLEKMVEEDECCRV 599
            ..|.:|:..:.:|...|||..||..|.|.|..    |.:.:..:|......|.|:.: .|:..||
 Frog   120 IRYVNGQSFQPNCKYNCTCVNGDVGCVPLCTNSRPPLVWCQNPKRVKMTGKCCEQWI-CDDFKRV 183

  Fly   600 MECSEPQLEPTVVATEGAAPSTNGTGESAVTLPTTDDEATPKPRTDCHYNSGVYKFRERLEIGCE 664
            .:.|...:         |:|:..|..||                  .|.|               
 Frog   184 RKTSPRHI---------ASPAYGGESES------------------WHNN--------------- 206

  Fly   665 QICHCAEGGVMDCRPRCPERNHTRL----DKCVYVKDPKDVCCQLELCDVTLDDHEQQPTPLQSN 725
              |.........|...|.....||:    |||...|:.:  .|.:..|||.:..|.:......|.
 Frog   207 --CIVQTTSWSPCSKTCGLGISTRISNENDKCRLRKERR--LCDMRPCDVDITQHIRTGKKCLSV 267

  Fly   726 NNE-DPEEID--------PFRFQEQARDAGGAKPTCT-------FKGAEYDVGQQFRDGCD---- 770
            ..| :|:...        |:|    .:..|    .||       :|.....|..:..||..    
 Frog   268 YREAEPKNFTISGCLSKRPYR----PKYCG----VCTDDRCCIPYKSKTIQVEFECPDGSGFTWN 324

  Fly   771 ----QLCICNEQGIHCAKLECPSNFGLDVQDPH 799
                ..|.||   :.|.|   |::...|:|..|
 Frog   325 VMWINACFCN---LSCRK---PNDIFADLQSYH 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sasNP_001262337.1 VWC 752..824 CDD:214564 15/63 (24%)
fn3 1413..1479 CDD:278470
FN3 1516..1605 CDD:238020
ccn4XP_002939562.2 IGFBP 41..93 CDD:365955 8/31 (26%)
VWC 115..173 CDD:327433 16/57 (28%)
GHB_like 273..337 CDD:389804 13/74 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11348
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.