DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sas and ccn2b

DIOPT Version :9

Sequence 1:NP_001262337.1 Gene:sas / 40861 FlyBaseID:FBgn0002306 Length:1693 Species:Drosophila melanogaster
Sequence 2:XP_005173827.1 Gene:ccn2b / 100124530 ZFINID:ZDB-GENE-070705-82 Length:351 Species:Danio rerio


Alignment Length:315 Identity:67/315 - (21%)
Similarity:96/315 - (30%) Gaps:133/315 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   663 CEQICHCAEGGVMDCRPRCPERNHTRLDKCVYVKDPKDVCCQLELCDVTLDDHEQQPTPLQSNNN 727
            |.|.|.|.     |..|.||......||.|        .||  ::|                   
Zfish    25 CSQPCDCP-----DESPLCPVGTSLVLDGC--------SCC--KVC------------------- 55

  Fly   728 EDPEEIDPFRFQEQARDAGGAKPTCTFKGAEYDVGQQFRDGCDQLCICNEQGIHCAKLECPSNFG 792
                          ||.||  :| |:           |.:.||     :.:|::|       ::.
Zfish    56 --------------ARQAG--EP-CS-----------FLEPCD-----HHKGLYC-------DYS 80

  Fly   793 L--DVQDPHCIRWEPVPADFKPSPPNCCPESMRCVDNGTCSYQGV---QIENWSPVPANLTGCDQ 852
            :  |.:...|:..|                      ..||...||   ..|.:.|      .|..
Zfish    81 VLSDTETGICMAQE----------------------GQTCDLGGVIYRSGETFQP------SCKH 117

  Fly   853 HCYCENGRVECRAACPPVPALPPADLPCHPALARLLPIPDDECCKHWMCAPQIP-----KIGGAG 912
            .|.|.||.:.|...|..:..||..|.| :|   |.:.|| .:||:.|:| .|||     :...||
Zfish   118 QCVCMNGEIGCVPTCATIIRLPSPDCP-YP---RRVQIP-GKCCEEWVC-DQIPQEDTFQSAVAG 176

  Fly   913 QDEETEATSTHSSIP----------ANETTTTTATANKSTSIPSKVPQIKKDEEK 957
            :.......|.|...|          ..|.:..:||.....|     .::..|.|:
Zfish   177 RSIAYREISAHGLQPESARDNCIVQTTEWSECSATCGMGVS-----SRVTNDNEQ 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sasNP_001262337.1 VWC 752..824 CDD:214564 9/73 (12%)
fn3 1413..1479 CDD:278470
FN3 1516..1605 CDD:238020
ccn2bXP_005173827.1 IGFBP 25..77 CDD:278641 24/118 (20%)
VWC 98..157 CDD:214564 21/69 (30%)
TSP1 201..242 CDD:214559 6/31 (19%)
GHB_like 252..335 CDD:304424
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11348
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.