DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sas and ccn5

DIOPT Version :9

Sequence 1:NP_001262337.1 Gene:sas / 40861 FlyBaseID:FBgn0002306 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_001186030.1 Gene:ccn5 / 100007759 ZFINID:ZDB-GENE-060223-1 Length:344 Species:Danio rerio


Alignment Length:285 Identity:60/285 - (21%)
Similarity:87/285 - (30%) Gaps:113/285 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   660 EIGCEQI---CHCAEGGVMDCRPRCPERNHTRLDKCVYVKDPKDVCCQLELCDVTLDDHEQQPTP 721
            ::.|:|.   |.| :|.|    |.|||.....||.|        .|||  :|             
Zfish    25 QVCCQQCGSSCQC-QGSV----PSCPEGVPLILDGC--------QCCQ--VC------------- 61

  Fly   722 LQSNNNEDPEEIDPFRFQEQARDAGGAKPTCTFKGAEYDVGQQFRDGCDQLCICN-EQGIHCAKL 785
                                ||..|                    :.|.::..|: ::|:.|   
Zfish    62 --------------------ARQQG--------------------EACSEVFPCDGQRGLQC--- 83

  Fly   786 ECPSNFGLDVQDPHCIRWEPVPADFKPSPPNCCPE-SMRCVDNGTCSYQGVQIENWSPVPANLTG 849
                               ...|.|...|..|..: .:.|..||. |||..|:  :.|      .
Zfish    84 -------------------DYSASFPGEPGECVSQKELGCELNGV-SYQEGQV--FQP------S 120

  Fly   850 CDQHCYCENGRVECRAACPPVPALPPADLPCHPALARLLPIPDDECCKHWMCAPQIPKIGGAGQD 914
            |...|.|..|.|.|...|.....||..|.| ||...:    |..:|||.|:|    ..:......
Zfish   121 CSLQCQCSGGGVTCVPQCREDVLLPTPDCP-HPRRVQ----PPGKCCKEWVC----ENLDNTVLQ 176

  Fly   915 EETEATSTHSSIPANETTTTTATAN 939
            :...|:.:..::||:....|...:|
Zfish   177 DAHIASKSDLTLPADSGYQTRVVSN 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sasNP_001262337.1 VWC 752..824 CDD:214564 8/73 (11%)
fn3 1413..1479 CDD:278470
FN3 1516..1605 CDD:238020
ccn5NP_001186030.1 IGFBP 31..83 CDD:278641 21/119 (18%)
VWC 104..163 CDD:214564 23/72 (32%)
GHB_like 266..334 CDD:304424
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11348
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.