DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and MAGEC1

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_005453.2 Gene:MAGEC1 / 9947 HGNCID:6812 Length:1142 Species:Homo sapiens


Alignment Length:250 Identity:59/250 - (23%)
Similarity:97/250 - (38%) Gaps:65/250 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SQEAQQPVD------------------------------VVDAKVRAILNYILDHTAQKIPIKDK 50
            |:|:..|||                              .:|.||..:..::|.....|.||...
Human   868 SEESSSPVDEYTSSSDTLLESDSLTDSESLIESEPLFTYTLDEKVDELARFLLLKYQVKQPITKA 932

  Fly    51 DLIAVAGDKSELKKRLPLVTNLLAE----TFGIILTPLDA-TTKTFI---------CTAEEPVAS 101
            :::  ....|......|::.....|    .|||.|..:|. .:..|:         |.::|...|
Human   933 EML--TNVISRYTGYFPVIFRKAREFIEILFGISLREVDPDDSYVFVNTLDLTSEGCLSDEQGMS 995

  Fly   102 IHELTPAQRPQFTLLYIILMYIFLRGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFV 166
                      |..||.:||..||::|....:..::.:|..:.:....||..|| ..|:.:.:.:|
Human   996 ----------QNRLLILILSIIFIKGTYASEEVIWDVLSGIGVRAGREHFAFG-EPRELLTKVWV 1049

  Fly   167 KQQYLK-RE--RSQLSAYDDSKTFFLWGPRAKAEFTFEQMVQFASKLLNQHPKVF 218
            ::.||: ||  .|....|:     |||||||.:|....::|:|.:.|.|..|..|
Human  1050 QEHYLEYREVPNSSPPRYE-----FLWGPRAHSEVIKRKVVEFLAMLKNTVPITF 1099

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 45/181 (25%)
MAGEC1NP_005453.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..132
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 502..778
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 791..893 5/24 (21%)
MAGE 915..1082 CDD:279759 45/184 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1118..1142
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151975
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.