Sequence 1: | NP_649702.2 | Gene: | MAGE / 40860 | FlyBaseID: | FBgn0037481 | Length: | 232 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_005453.2 | Gene: | MAGEC1 / 9947 | HGNCID: | 6812 | Length: | 1142 | Species: | Homo sapiens |
Alignment Length: | 250 | Identity: | 59/250 - (23%) |
---|---|---|---|
Similarity: | 97/250 - (38%) | Gaps: | 65/250 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 SQEAQQPVD------------------------------VVDAKVRAILNYILDHTAQKIPIKDK 50
Fly 51 DLIAVAGDKSELKKRLPLVTNLLAE----TFGIILTPLDA-TTKTFI---------CTAEEPVAS 101
Fly 102 IHELTPAQRPQFTLLYIILMYIFLRGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFV 166
Fly 167 KQQYLK-RE--RSQLSAYDDSKTFFLWGPRAKAEFTFEQMVQFASKLLNQHPKVF 218 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
MAGE | NP_649702.2 | MAGE | 36..201 | CDD:279759 | 45/181 (25%) |
MAGEC1 | NP_005453.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..132 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 502..778 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 791..893 | 5/24 (21%) | |||
MAGE | 915..1082 | CDD:279759 | 45/184 (24%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1118..1142 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165151975 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4562 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1195799at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000171 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR11736 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.940 |