DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and MAGED1

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001005333.1 Gene:MAGED1 / 9500 HGNCID:6813 Length:834 Species:Homo sapiens


Alignment Length:238 Identity:73/238 - (30%)
Similarity:117/238 - (49%) Gaps:28/238 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SQNAIPSQE--AQQPVDVVDAKVRA--ILNYIL--DHTAQKIPIKD----KDLIAVAGD-KSELK 63
            |.|:..||.  |.||.||...:.||  ::.|::  |:|  |:|||.    :|:|....| ..|:.
Human   507 SPNSRASQNPGAAQPRDVALLQERANKLVKYLMLKDYT--KVPIKRSEMLRDIIREYTDVYPEII 569

  Fly    64 KRLPLVTNLLAETFGIILTPLDATTKTFI-CTAEEPVASIHELTPAQRPQFTLLYIILMYIFLRG 127
            :|...|   |.:.|||.|..:|.....:| .:..|.:|.|.. |....|:..||.:||..||:.|
Human   570 ERACFV---LEKKFGIQLKEIDKEEHLYILISTPESLAGILG-TTKDTPKLGLLLVILGVIFMNG 630

  Fly   128 NRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRER---SQLSAYDDSKTFFL 189
            ||..::.|:..|..:.:.|...|...| :|||.:...||||:||...|   |....|:     ||
Human   631 NRASEAVLWEALRKMGLRPGVRHPLLG-DLRKLLTYEFVKQKYLDYRRVPNSNPPEYE-----FL 689

  Fly   190 WGPRAKAEFTFEQMVQFASKLLNQHPKVF-GHHLSMAQEGVNA 231
            ||.|:..|.:..::::|.:::..:.|:.: ...:..|.|.::|
Human   690 WGLRSYHETSKMKVLRFIAEVQKRDPRDWTAQFMEAADEALDA 732

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 57/175 (33%)
MAGED1NP_001005333.1 MAGE 534..694 CDD:279759 55/171 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151958
Domainoid 1 1.000 63 1.000 Domainoid score I10231
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.