DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Maged1

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_062765.1 Gene:Maged1 / 94275 MGIID:1930187 Length:775 Species:Mus musculus


Alignment Length:245 Identity:74/245 - (30%)
Similarity:120/245 - (48%) Gaps:30/245 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASTSRAARSQNAIPSQEAQQPVDVVDAKVRA--ILNYIL--DHTAQKIPIKD----KDLIAVAG 57
            :.|:|.:..|||    |...||.||...:.||  ::.|::  |:|  |:|||.    :|:|....
Mouse   445 LRSSSNSRASQN----QGPPQPRDVALLQERANKLVKYLMLKDYT--KVPIKRSEMLRDIIREYT 503

  Fly    58 D-KSELKKRLPLVTNLLAETFGIILTPLDATTKTFI-CTAEEPVASIHELTPAQRPQFTLLYIIL 120
            | ..|:.:|...|   |.:.|||.|..:|.....:| .:..|.:|.|.. |....|:..||.:||
Mouse   504 DVYPEIIERACFV---LEKKFGIQLKEIDKEEHLYILISTPESLAGILG-TTKDTPKLGLLLVIL 564

  Fly   121 MYIFLRGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRER---SQLSAYD 182
            ..||:.|||..::.|:..|..:.:.|...|...| :|||.:...||||:||...|   |....|:
Mouse   565 GIIFMNGNRATEAVLWEALRKMGLRPGVRHPLLG-DLRKLLTYEFVKQKYLDYRRVPNSNPPEYE 628

  Fly   183 DSKTFFLWGPRAKAEFTFEQMVQFASKLLNQHPKVF-GHHLSMAQEGVNA 231
                 ||||.|:..|.:..::::|.:::..:.|:.: ...:..|.|.::|
Mouse   629 -----FLWGLRSYHETSKMKVLRFIAEVQKRDPRDWTAQFMEAADEALDA 673

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 57/175 (33%)
Maged1NP_062765.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..330
22 X 6 AA tandem repeats of W-[PQ]-X-P-X-X 292..441
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 374..409
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 437..463 7/21 (33%)
MAGE 475..635 CDD:279759 55/171 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842084
Domainoid 1 1.000 53 1.000 Domainoid score I11275
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42492
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.