DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and NSE3

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_010574.1 Gene:NSE3 / 851882 SGDID:S000002696 Length:303 Species:Saccharomyces cerevisiae


Alignment Length:243 Identity:53/243 - (21%)
Similarity:88/243 - (36%) Gaps:59/243 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AARSQNAIPSQEAQQPVDVVDAKVRAILNYILDHTAQKIPIKDKDLIAVAGDKSELKKRLPLVTN 71
            |||.:|......::..:|     :.|||..:.....|.:|.|:.......|..|...|.:|....
Yeast    58 AAREENIAKPSFSKMFMD-----INAILYNVYGFELQGLPSKNNMNAGGNGSNSNTNKSMPEPLG 117

  Fly    72 LLAETFGIILTPLD--------------ATTKTFICTAE---EPVAS--IHELTPAQRPQFTLLY 117
            ..|:.| |:|..:.              .|.:..|.|.|   :.:||  .:.|.........|:|
Yeast   118 HRAQKF-ILLNNVPHSKNFDDFKILQSAHTYEELIVTGEYIGDDIASGTSNTLESKLSTDRDLVY 181

  Fly   118 -----IILMYIFLRGNRIEDSKLYVMLE------------MLNIYPDEEHGYFGPNLRKQIEETF 165
                 :||..:|...|.|...:|...||            :|||..::        |.|.:|   
Yeast   182 KGVLSVILCIVFFSKNNILHQELIKFLETFGIPSDGSKIAILNITIED--------LIKSLE--- 235

  Fly   166 VKQQYLKR--ERSQLSAYDDSKTFFLWGPRAKAEFTFEQMVQFASKLL 211
             |::|:.|  |:|..   |.....:..|.|.:||...|.:.:...:::
Yeast   236 -KREYIVRLEEKSDT---DGEVISYRIGRRTQAELGLESLEKLVQEIM 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 44/202 (22%)
NSE3NP_010574.1 MAGE 31..269 CDD:396164 52/231 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11736
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.