DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and CHS5

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_013434.1 Gene:CHS5 / 851041 SGDID:S000004322 Length:671 Species:Saccharomyces cerevisiae


Alignment Length:150 Identity:28/150 - (18%)
Similarity:50/150 - (33%) Gaps:57/150 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AQQPVDVVDAKVRAILNYILDHTAQKIPIKDK-------------------DLIAVAGDKSELKK 64
            |..|:.:..||:::::.|.....:..||...|                   .||..:|  :...:
Yeast    97 AWDPLKLGSAKLKSLILYRKGIRSMVIPNPFKVTTTKISGLSVDTPYEFQLKLITTSG--TLWSE 159

  Fly    65 RLPLVTNLLAETFGI--ILTPLD---------------------------ATTKTFIC------- 93
            ::.|.|:.:.:..||  .|.|||                           ..|..|:|       
Yeast   160 KVILRTHKMTDMSGITVCLGPLDPLKEISDLQISQCLSHIGARPLQRHVAIDTTHFVCNDLDNEE 224

  Fly    94 TAEEPVASIHELTPAQRPQF 113
            :.||.:.:.|...|..||::
Yeast   225 SNEELIRAKHNNIPIVRPEW 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 24/132 (18%)
CHS5NP_013434.1 Chs5_N 4..76 CDD:260117
fn3_2 77..165 CDD:407129 12/69 (17%)
BRCT_CHS5_like 172..255 CDD:349373 15/72 (21%)
MDN1 <366..607 CDD:227596
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2068
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.