DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Maged1

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_445861.1 Gene:Maged1 / 84469 RGDID:70898 Length:775 Species:Rattus norvegicus


Alignment Length:240 Identity:71/240 - (29%)
Similarity:118/240 - (49%) Gaps:26/240 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RAARSQNAIPSQEAQQPVDVVDAKVRA--ILNYIL--DHTAQKIPIKD----KDLIAVAGD-KSE 61
            |::.:..|..:|...||.||...:.||  ::.|::  |:|  |:|||.    :|:|....| ..|
  Rat   446 RSSPNSRASQNQGPPQPRDVALLQERANKLVKYLMLKDYT--KVPIKRSEMLRDIIREYTDVYPE 508

  Fly    62 LKKRLPLVTNLLAETFGIILTPLDATTKTFI-CTAEEPVASIHELTPAQRPQFTLLYIILMYIFL 125
            :.:|...|   |.:.|||.|..:|.....:| .:..|.:|.|.. |....|:..||.:||..||:
  Rat   509 IIERACFV---LEKKFGIQLKEIDKEEHLYILISTPESLAGILG-TTKDTPKLGLLLVILGIIFM 569

  Fly   126 RGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRER---SQLSAYDDSKTF 187
            .|||..::.|:..|..:.:.|...|...| :|||.:...||||:||...|   |....|:     
  Rat   570 NGNRATEAVLWEALRKMGLRPGVRHPLLG-DLRKLLTYEFVKQKYLDYRRVPNSNPPEYE----- 628

  Fly   188 FLWGPRAKAEFTFEQMVQFASKLLNQHPKVF-GHHLSMAQEGVNA 231
            ||||.|:..|.:..::::|.:::..:.|:.: ...:..|.|.::|
  Rat   629 FLWGLRSYHETSKMKVLRFIAEVQKRDPRDWTAQFMEAADEALDA 673

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 57/175 (33%)
Maged1NP_445861.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..330
22 X 6 AA tandem repeats of W-[PQ]-X-P-X-X 293..441
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 374..407
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 437..463 4/16 (25%)
MAGE 475..635 CDD:279759 55/171 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345484
Domainoid 1 1.000 55 1.000 Domainoid score I10828
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44556
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.