DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and AT1G34770

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001321419.1 Gene:AT1G34770 / 840381 AraportID:AT1G34770 Length:250 Species:Arabidopsis thaliana


Alignment Length:238 Identity:55/238 - (23%)
Similarity:100/238 - (42%) Gaps:52/238 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PSQ---EAQQPVDV----VDAKVRAILNYIL--DHTAQKIPIKDKDLIAVAGDK----------- 59
            |||   ::....|:    .|..|..::.:||  .|.:...|||.:||..:....           
plant    13 PSQFLPDSLSQFDISKEETDKLVSEVIRFILFKFHQSSGTPIKREDLTQIVTKNYRQRNLATHVI 77

  Fly    60 SELKKRLPLVTNLLAETFGIILTPL------------------DATTKTFICTAEEP--VASIHE 104
            :|.||:       |:..||..|..|                  ...:|:::..:|.|  |...|.
plant    78 NEAKKK-------LSNVFGYDLKELQRARSSSTGQSRLPQSQSSVDSKSYVLVSELPLEVFKKHV 135

  Fly   105 LTPAQRPQFTLLYIILMYIFLRGNRIEDSKLYVMLEMLNIYPDEEHG-YFGPNLRKQIEETFVKQ 168
            :.....|.....:::|..:.|.|.:|.:..|:..|:.:.::.::||. .||.|  ||..||.|:|
plant   136 VDETTSPVTGFTFVVLAIVQLAGGKIPEETLWHHLKRMGLHENDEHNPVFGNN--KQTLETLVQQ 198

  Fly   169 QYLKRERSQLSAYDDSKTFFLWGPRAKAEFTFEQMVQFASKLL 211
            ::|::|:  :|..:.|..|:....||......|::..:.|::|
plant   199 RFLQKEK--VSGPEGSTLFYDLAERALDPQVSEKVKDYISQIL 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 46/198 (23%)
AT1G34770NP_001321419.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105159
Panther 1 1.100 - - LDO PTHR11736
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.