DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Maged2

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001186175.1 Gene:Maged2 / 80884 MGIID:1933391 Length:616 Species:Mus musculus


Alignment Length:238 Identity:68/238 - (28%)
Similarity:112/238 - (47%) Gaps:31/238 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RAARSQNAIPSQEAQQP----VDVVDAKVRAILNYILDHTAQKIPIKDKDLIAVAGDKSELKKRL 66
            |||:.|:   |||.:.|    |.::..:...::.|:|.....||||:..|::     |..:|:..
Mouse   258 RAAKLQS---SQEPEAPPPRDVALLQGRANDLVKYLLAKDQTKIPIRRSDML-----KDIIKEYT 314

  Fly    67 PLVTNL-------LAETFGIILTPLDATTKTFI--CTAEEPVASIHELTPAQRPQFTLLYIILMY 122
            .:...:       |.:.|||.|..:|.....:|  .|.|...|.|.. |....|:..||.::|..
Mouse   315 DVYPEIIERAGYSLEKVFGIQLKEIDKNDHLYILLSTLEPTDAGILG-TTKDSPKLGLLMVLLSI 378

  Fly   123 IFLRGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRER---SQLSAYDDS 184
            ||:.|||..::.::.:|..|.:.|...|..|| :::|.|.:.||||:||...|   |....|:  
Mouse   379 IFMNGNRSSEAVIWEVLRKLGLRPGIHHSLFG-DVKKLITDEFVKQKYLDYARVPNSNPPEYE-- 440

  Fly   185 KTFFLWGPRAKAEFTFEQMVQFASKLLNQHPKVFGHHLSMAQE 227
               |.||.|:..|.:..::::||.|:..:.||.:......|.|
Mouse   441 ---FFWGLRSYYETSKMKVLKFACKVQKKDPKEWAAQYREAME 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 52/176 (30%)
Maged2NP_001186175.1 PRK13335 32..>125 CDD:139494
PRK13914 <33..224 CDD:237555
MAGE 286..454 CDD:366651 52/179 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842086
Domainoid 1 1.000 53 1.000 Domainoid score I11275
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42492
orthoMCL 1 0.900 - - OOG6_105159
Panther 1 1.100 - - LDO PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.