DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Mageh1

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_076277.1 Gene:Mageh1 / 75625 MGIID:1922875 Length:218 Species:Mus musculus


Alignment Length:162 Identity:42/162 - (25%)
Similarity:76/162 - (46%) Gaps:33/162 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 TPLDA-----TTKTFICTAEEPVASIHELT--------------PAQRPQF-----TLLYIILMY 122
            ||:.|     |.:.::...||..:::.:.:              |..|..|     :||..||..
Mouse    33 TPMAASVAPSTPEEYLSGPEEDTSTLEKASSTPSEASSTALVQKPVTRSNFQGTKKSLLMSILAL 97

  Fly   123 IFLRGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRE---RSQLSAYDDS 184
            ||:.||..:::.::.:|..|.:.|..:|..|| :.:|.:.|.||::.||..:   ||....|:  
Mouse    98 IFIMGNSAKEALVWKVLGKLGMQPGRQHSIFG-DPKKVVTEEFVRRGYLIYKPVPRSSPVEYE-- 159

  Fly   185 KTFFLWGPRAKAEFTFEQMVQFASKLLNQHPK 216
               |.|||||..|.:..:::.|.:::.|:..|
Mouse   160 ---FFWGPRAHVESSKLKVMHFVARVRNRCSK 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 39/145 (27%)
Mageh1NP_076277.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..75 6/41 (15%)
MAGE <55..169 CDD:279759 32/119 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842089
Domainoid 1 1.000 53 1.000 Domainoid score I11275
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42492
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.810

Return to query results.
Submit another query.