DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Nscme3l

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_076270.3 Gene:Nscme3l / 75555 MGIID:1922805 Length:294 Species:Mus musculus


Alignment Length:196 Identity:67/196 - (34%)
Similarity:99/196 - (50%) Gaps:9/196 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VDAKVRAILNYILDHTAQKIPIKDKDLI--AVAGDKSELKKRLPLVTNLLAETFGIILTPLDATT 88
            ::.||..::.::|....:|||||...::  .|...|:.....|.|....|...||..|..||..:
Mouse    75 LELKVAELVQFLLIKDQRKIPIKQSGIMKHVVRDYKNIFPDLLKLAAERLHYVFGYKLVELDPKS 139

  Fly    89 KTFI-CTAEEPVASIHELTPAQR-PQFTLLYIILMYIFLRGNRIEDSKLYVMLEMLNIYPDEEHG 151
            ..:| ..|.|||....||...|| |...||.|||..|.:.|:.|.::.::..|..|.:||.::|.
Mouse   140 NAYILINALEPVGKDGELRGYQRTPTTGLLMIILGLILMNGHSIPENDVWCFLRRLGVYPTKKHS 204

  Fly   152 YFG-PNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFLWGPRAKAEFTFEQMVQFASKLLNQHP 215
            .|| |  :|.|.|.||||:||:..|  :...|.......|||||..|.:..::::|.:|:.||.|
Mouse   205 VFGYP--KKLITEDFVKQRYLEYRR--IPHTDPVDCELQWGPRANLETSKMKVLKFVAKIHNQDP 265

  Fly   216 K 216
            |
Mouse   266 K 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 59/169 (35%)
Nscme3lNP_076270.3 MAGE 82..251 CDD:279759 59/172 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I11275
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I5107
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55398
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 1 1.000 - - otm42492
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.980

Return to query results.
Submit another query.