DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Magea13

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_076263.1 Gene:Magea13 / 75352 MGIID:1922602 Length:320 Species:Mus musculus


Alignment Length:229 Identity:62/229 - (27%)
Similarity:109/229 - (47%) Gaps:33/229 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 STSRAA-RSQNAIPSQEAQQPVDVVDAKVRAILNYILDHTAQKIPIKDKDLIAVAGDKSELKKRL 66
            |||:|. |::..:.|:..::.:|:|        .::........|:.:.:::...|.|.  |...
Mouse    68 STSKACLRTKLMLNSKFQKKVIDLV--------KFLSSKYVTNEPVTEAEILKSVGKKH--KGYY 122

  Fly    67 PLVTNLLAETF----GIILTPLDATTKTFICTAEEPVASIHELTPAQR-------PQFTLLYIIL 120
            .|:.....|..    ||.:..:||...|::      :..:.:||...|       |:..||.::|
Mouse   123 SLIFKHACECLEVVCGIEVKEVDALNHTYL------LLKVLDLTYDGRISNEEGIPKTGLLVLVL 181

  Fly   121 MYIFLRGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSK 185
            ..||:.|||..:.|::.:|.::.:||| :|.:...|.||.|.|..|.:.||.   .|...|.|..
Mouse   182 GIIFMEGNRASEKKIWEVLNIVGVYPD-QHDFICGNPRKFITEDLVLENYLV---YQPVPYSDPP 242

  Fly   186 TF-FLWGPRAKAEFTFEQMVQFASKLLNQHPKVF 218
            :: |||||||:||.:..:::||..|:...:|..|
Mouse   243 SYEFLWGPRAQAETSKMKVLQFFCKVAGSNPASF 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 49/176 (28%)
Magea13NP_076263.1 MAGE 91..259 CDD:366651 50/187 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842096
Domainoid 1 1.000 53 1.000 Domainoid score I11275
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I5107
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 1 1.000 - - otm42492
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.000

Return to query results.
Submit another query.