DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Magec2

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001186925.1 Gene:Magec2 / 74437 MGIID:1921687 Length:429 Species:Mus musculus


Alignment Length:227 Identity:59/227 - (25%)
Similarity:103/227 - (45%) Gaps:34/227 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SQNAIPSQEAQQPVDVVDAKVR-----AILNYILDHTAQKIPIKDKDLIAVAGDKSELKKRLPLV 69
            |...|.|.|  .|..::|..::     .:..:|..:.. |.||...::..|.  ..|.:...|::
Mouse   186 SSGVIASPE--DPDSLLDTVIQEKATDLVFLFIYKYRV-KEPITLTEMHEVV--TKEYENHFPVI 245

  Fly    70 ----TNLLAETFGIILTPLDATTKTFI------CTAEEPVASIHELTPAQRPQFTLLYIILMYIF 124
                :..|..||||.:...|..:..::      .|.|:.::....|     |:...|.:||..||
Mouse   246 FIEASKCLEMTFGIDIKESDLVSSAYVLVNSLNLTYEDTLSDSDRL-----PRNAFLIVILGVIF 305

  Fly   125 LRGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLK-RE--RSQLSAYDDSKT 186
            :.||...:.:::..|:::.:|..|||...| :.|:.:....|:|.||: ||  .||...::    
Mouse   306 IEGNCASEDRIWEFLKLVGVYDGEEHFICG-DPREFLTIHLVQQNYLEYREVPNSQPPCFE---- 365

  Fly   187 FFLWGPRAKAEFTFEQMVQFASKLLNQHPKVF 218
             |||||||.||.|..::::|.:|:....|..|
Mouse   366 -FLWGPRAYAETTKMKVLEFLAKMNGCDPSDF 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 49/177 (28%)
Magec2NP_001186925.1 MAGE 224..379 CDD:366651 47/167 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842079
Domainoid 1 1.000 53 1.000 Domainoid score I11275
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I5107
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42492
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.