DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Magea14

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_083127.1 Gene:Magea14 / 74279 MGIID:1921529 Length:284 Species:Mus musculus


Alignment Length:109 Identity:34/109 - (31%)
Similarity:60/109 - (55%) Gaps:5/109 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 PQFTLLYIILMYIFLRGNRIEDSKLYVMLEMLNIYPDEEHGYFG-PNLRKQIEETFVKQQYLKRE 174
            |:..||.|:|..||::.|...:.:|:.:|..:.:|...:|..:| |.:  .|.|.||::.||  |
Mouse   165 PKIGLLIIVLCIIFIQDNCASEQELWRILNNMGLYAGRDHFIYGDPGV--LITEHFVQEGYL--E 225

  Fly   175 RSQLSAYDDSKTFFLWGPRAKAEFTFEQMVQFASKLLNQHPKVF 218
            ..|:...|.....:||||||.||.|..::::..:.::.|.|:.:
Mouse   226 CRQVPGSDPPTREYLWGPRAHAETTKMKVLKHFASIVKQDPRSY 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 32/90 (36%)
Magea14NP_083127.1 MAGE_N 16..66 CDD:372109
MAGE 100..252 CDD:366651 32/90 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842080
Domainoid 1 1.000 53 1.000 Domainoid score I11275
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I5107
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42492
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.