DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and MAGEA9B

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001074259.1 Gene:MAGEA9B / 728269 HGNCID:31909 Length:315 Species:Homo sapiens


Alignment Length:242 Identity:55/242 - (22%)
Similarity:108/242 - (44%) Gaps:39/242 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SQEAQQPVDVVD-------------AKVRAILNYILDHTAQKIPIKDKDLIAVAGDKSELKKRLP 67
            |||.::|...||             .||..:::::|.....|.|:...:::...  ....|:..|
Human    85 SQEEEEPSSSVDPAQLEFMFQEALKLKVAELVHFLLHKYRVKEPVTKAEMLESV--IKNYKRYFP 147

  Fly    68 LVTNLLAE----TFGIILTPLDATTKTFI------CTAEEPVASIHELTPAQRPQFTLLYIILMY 122
            ::....:|    .||..:..:|....::|      .:.:..:...|.:     |:..||.|:|..
Human   148 VIFGKASEFMQVIFGTDVKEVDPAGHSYILVTALGLSCDSMLGDGHSM-----PKAALLIIVLGV 207

  Fly   123 IFLRGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTF 187
            |..:.|...:..::..|.::.:|..:||.::| ..||.:.:.:|::.||  |..|:...|.:...
Human   208 ILTKDNCAPEEVIWEALSVMGVYVGKEHMFYG-EPRKLLTQDWVQENYL--EYRQVPGSDPAHYE 269

  Fly   188 FLWGPRAKAEFTFEQMVQFASKLLNQ-----HPKVFGHHLSMAQEGV 229
            ||||.:|.||.::|:::.:. .:||.     :|.::...|...||||
Human   270 FLWGSKAHAETSYEKVINYL-VMLNAREPICYPSLYEEVLGEEQEGV 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 38/174 (22%)
MAGEA9BNP_001074259.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..67
MAGE_N 5..80 CDD:315167
MAGE 128..279 CDD:307557 34/160 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151966
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5087
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.