DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and MAGED4

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001258990.1 Gene:MAGED4 / 728239 HGNCID:23793 Length:757 Species:Homo sapiens


Alignment Length:261 Identity:69/261 - (26%)
Similarity:120/261 - (45%) Gaps:40/261 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AARSQNAIPSQEA----QQPVDVVDAKVRAILNYILDHTAQKIPIKDKDLI--AVAGDKSELKKR 65
            |.|||  |||:..    .:.|.::..:...::.|::....:|||||..|::  .:........:.
Human   392 APRSQ--IPSRHVLCLPPRNVTLLQERANKLVKYLMIKDYKKIPIKRADMLKDVIREYDEHFPEI 454

  Fly    66 LPLVTNLLAETFGIILTPLDATTKTFI--CTAEEPVASIHELTPAQRPQFTLLYIILMYIFLRGN 128
            :...|..|.:.|||.|..:|.....:|  ||.:.....:.:  ....|:.:||.:||..||:.||
Human   455 IERATYTLEKKFGIHLKEIDKEEHLYILVCTRDSSARLLGK--TKDTPRLSLLLVILGVIFMNGN 517

  Fly   129 RIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLK-RERSQLSA----YDDSKTF- 187
            |..::.|:..|..:.:.|...|.:.| :|||.|.:.||||:..: ||.:.||.    |.:.|.. 
Human   518 RASEAVLWEALRKMGLRPGVRHPFLG-DLRKLITDDFVKQKNPELREETPLSMAPSWYLEYKKIP 581

  Fly   188 --------FLWGPRAKAEFTFEQMVQFASKLLNQHPKVFGHH-------------LSMAQEGVNA 231
                    ||||.||:.|.:..::::|.::..|:.|:.:..|             :.||:|...|
Human   582 NSNPPEYEFLWGLRARHETSKMRVLRFIAQNQNRDPREWKAHFLEAVDDAFKTMDVDMAEEHARA 646

  Fly   232 E 232
            :
Human   647 Q 647

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 53/182 (29%)
MAGED4NP_001258990.1 DUF3123 <250..304 CDD:288214
MAGE 420..603 CDD:279759 53/185 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151949
Domainoid 1 1.000 63 1.000 Domainoid score I10231
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2068
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.