DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Mageb16

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001107206.1 Gene:Mageb16 / 71967 MGIID:1919217 Length:363 Species:Mus musculus


Alignment Length:268 Identity:67/268 - (25%)
Similarity:115/268 - (42%) Gaps:55/268 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASTS--------RAARSQNAIPSQEAQ--------------QPVDVVDAKVRAILNYILDHTAQK 44
            ||||        .::.|...:..||.|              .||..||.||..::||:|.....|
Mouse    82 ASTSSDLQHPYDSSSESTEDLDDQEVQGSPVIPPDQSDSTDLPVMTVDGKVDFLVNYMLYKYQVK 146

  Fly    45 IPIKDKDL--IAVAGDKSELKKRLPLVTNLLAETFGIILTPLDATTKTFICTAEEPVASIHEL-- 105
            ..:...|:  :.|..|:....:.|...:..:...||:.:..:|            |:...:.|  
Mouse   147 EVMSMNDIMTLIVREDEDRFHEILMRASERMEMVFGLDVKEVD------------PINHCYALFI 199

  Fly   106 -----------TPAQRPQFTLLYIILMYIFLRGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRK 159
                       .....|:..||.:||..:|::|||..:.:::.:|..:.||....|..|| :.|:
Mouse   200 KLGLTYDGMRNDEYSFPKTGLLILILGVVFMKGNRATEEEIWEVLNPMGIYAGMTHFMFG-DPRE 263

  Fly   160 QIEETFVKQQYLKRERSQLSAYDDSKTFFLWGPRAKAEFTFEQMVQFASKLLNQHPKVFGHHLSM 224
            .|.:.||::|||  |...::..|..:..::||.|||||.:..::::|.:|:....|.||   ||.
Mouse   264 LITDEFVREQYL--EYQPIANSDPIQYEYVWGLRAKAETSKMRVLEFVAKVHGSDPTVF---LSQ 323

  Fly   225 AQEGVNAE 232
            .:|.:..|
Mouse   324 YEEALIEE 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 43/179 (24%)
Mageb16NP_001107206.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..124 8/41 (20%)
MAGE <217..303 CDD:366651 30/88 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 342..363
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842095
Domainoid 1 1.000 53 1.000 Domainoid score I11275
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I5107
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 1 1.000 - - otm42492
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.900

Return to query results.
Submit another query.