DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and LOC682831

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_003752106.1 Gene:LOC682831 / 682831 RGDID:1594017 Length:330 Species:Rattus norvegicus


Alignment Length:214 Identity:52/214 - (24%)
Similarity:103/214 - (48%) Gaps:14/214 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RSQNAIPSQEAQQPVDVVDAKVRAILNYILDHTAQKIPIKDKDLIAVAGDKSELK---KRLPLVT 70
            |:.:.|.:|      |::..||..::..:|.:...|.....:|::.|. ||.|:.   :.|....
  Rat    80 RNYHTINNQ------DLLARKVLVLVQILLKNYKIKQLTTMEDMMQVI-DKEEINDFPEMLRKAA 137

  Fly    71 NLLAETFGIILTPLDATTKTFICTAEEPVASIHELTPAQR-PQFTLLYIILMYIFLRGNRIEDSK 134
            ..||:.|.:.|..::::.:.:...::..:.:...:...|. |:...|..:|..||:.||...:..
  Rat   138 ERLADVFAVELREVESSRRVYDLISKLKLPNNGRVRAGQGFPKTGFLMTVLGIIFMSGNCAREED 202

  Fly   135 LYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFLWGPRAKAEFT 199
            ::..|..:.:|..::|..:| ..||.|.:.|||.:||  |..|::..:..:..|||||:|.||..
  Rat   203 IWRTLRYMGVYSGKKHQIYG-EPRKLITQNFVKLKYL--EYRQVANSNPPQYEFLWGPKAYAETN 264

  Fly   200 FEQMVQFASKLLNQHPKVF 218
            ...:::|.:|:.:..|..|
  Rat   265 KMTILKFVAKVNDIPPSCF 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 42/168 (25%)
LOC682831XP_003752106.1 MAGE 119..262 CDD:279759 37/146 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.