DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Magel2

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_001054803.3 Gene:Magel2 / 679875 RGDID:1583615 Length:1258 Species:Rattus norvegicus


Alignment Length:222 Identity:59/222 - (26%)
Similarity:106/222 - (47%) Gaps:13/222 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 STSRAARSQNAIPSQEAQQPVDVVDAKVRAILNYILDHTAQKIPIKDKDLIAVA-----GDKSEL 62
            |.||.:.:....|.:|. ||:..:|.:..|::.::|.....|:|::..:::.|.     .|..::
  Rat  1006 SVSRGSSTAQEDPDRET-QPLSPLDERANALVQFLLVKDQAKVPVQLSEMVNVVIREYKDDSLDI 1069

  Fly    63 KKRLPLVTNLLAETFGIILTPLDATTKTFICTAEEPVASIHELTP-AQRPQFTLLYIILMYIFLR 126
            ..|   ....|..|||..|..:||.|.|:|...:......:.|.. .:||:|:||.::|..||::
  Rat  1070 INR---ANTKLECTFGCQLKEVDAKTHTYIIVNKMAYPQCNLLASYLERPKFSLLMVVLSLIFMK 1131

  Fly   127 GNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFLWG 191
            |..|.::.|:..|..|.:...|....|... :|.|...||:.:||  |..|:...:.::...|||
  Rat  1132 GYCIRENLLFSFLFQLGLDVQETSSLFRIT-KKLITSVFVRHRYL--EYRQIPFTEPAEYELLWG 1193

  Fly   192 PRAKAEFTFEQMVQFASKLLNQHPKVF 218
            |||..|.....:::|.:.|....|:::
  Rat  1194 PRAFLETNRVHILRFLAALYENQPQIW 1220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 47/170 (28%)
Magel2XP_001054803.3 PHA03247 <14..585 CDD:223021
PRK07764 <492..902 CDD:236090
MAGE 1035..1199 CDD:396164 46/169 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345488
Domainoid 1 1.000 55 1.000 Domainoid score I10828
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44556
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.