DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Mageb6b2

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_030107399.1 Gene:Mageb6b2 / 667988 MGIID:3646464 Length:344 Species:Mus musculus


Alignment Length:206 Identity:55/206 - (26%)
Similarity:97/206 - (47%) Gaps:22/206 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DVVDAKVRAILNYILD-HTAQKIPIKDKDLIAVAGDKSELKKRLPLV----TNLLAETFGIILTP 83
            |.:..|...:|:|:|: :...:.|: :.:::.:.|.|  .|...|.:    |..|...:|:.|..
Mouse   109 DPLTRKASKVLHYLLEKYQKDEQPV-EGEMLKLIGRK--YKVHFPQILEKATYQLELVYGLELKV 170

  Fly    84 LDATTKTFICTAEEP------VASIHELTPAQRPQFTLLYIILMYIFLRGNRIEDSKLYVMLEML 142
            .:..|.:::..::.|      |....||     |:..|:..||..||::|||..:.:::..|.|.
Mouse   171 DNPATHSYVLVSKLPILPGADVGGRREL-----PKTGLILTILGMIFMKGNRATEEEVWQFLHMQ 230

  Fly   143 NIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFLWGPRAKAEFTFEQMVQFA 207
            .|||...|..|| ..|..|.:..|:|.|:  |..|:...|.....|||||||..|.|:.:::...
Mouse   231 GIYPGRRHLIFG-EPRNFITKVLVEQNYV--EYRQVPGSDPPTHEFLWGPRAHEESTYRKVMDIL 292

  Fly   208 SKLLNQHPKVF 218
            :|:.:..|..:
Mouse   293 AKIKSAIPSYY 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 50/175 (29%)
Mageb6b2XP_030107399.1 MAGE_N 6..84 CDD:372109
MAGE 139..282 CDD:366651 45/152 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842092
Domainoid 1 1.000 53 1.000 Domainoid score I11275
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I5107
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42492
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.850

Return to query results.
Submit another query.