DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Nsmce3

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_075728.1 Gene:Nsmce3 / 66647 MGIID:1913897 Length:279 Species:Mus musculus


Alignment Length:228 Identity:75/228 - (32%)
Similarity:120/228 - (52%) Gaps:21/228 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 STSRAA--RSQNAIPSQEA-------QQPVDVVDAKVRAILNYILDHTAQKIPIKDKDLIA-VAG 57
            ||||||  .||.:..|..|       |:.:::   ||..::.::|....:|||||..|::. |.|
Mouse    30 STSRAAGGSSQGSRASLSAPTVGPRTQKQLEL---KVAELVQFLLIKDQKKIPIKRTDILKHVVG 91

  Fly    58 DKSEL-KKRLPLVTNLLAETFGIILTPLDATTKTFI-CTAEEPVASIHELTPAQ-RPQFTLLYII 119
            |..:: ...|.|....|...||..|..|:..:.::| ....|||.:..|:...| .|...||.|:
Mouse    92 DYRDVYPNLLKLAAERLQYVFGYKLVELEPKSHSYILINMLEPVEADAEMRGDQGTPISGLLMIV 156

  Fly   120 LMYIFLRGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDS 184
            |..||::||.|.:::::..|..|.:||.::|..|| :.:|.|.|.||:|:||:..|   ..:.|.
Mouse   157 LGLIFMKGNTITETEVWDFLRRLGVYPTKKHLIFG-DPKKLITEDFVRQRYLEYRR---IPHTDP 217

  Fly   185 KTFFL-WGPRAKAEFTFEQMVQFASKLLNQHPK 216
            ..:.| ||||...|.:..::::|.:|:.||.||
Mouse   218 VDYELQWGPRTNLETSKMKVLKFVAKVHNQDPK 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 56/169 (33%)
Nsmce3NP_075728.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 10/21 (48%)
Interaction with NSMCE1. /evidence=ECO:0000250 52..279 65/206 (32%)
MAGE 66..235 CDD:279759 56/172 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I11275
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I5107
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55398
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 1 1.000 - - otm42492
orthoMCL 1 0.900 - - OOG6_105159
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2068
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.870

Return to query results.
Submit another query.