DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and MAGEB17

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001264236.1 Gene:MAGEB17 / 645864 HGNCID:17418 Length:336 Species:Homo sapiens


Alignment Length:244 Identity:58/244 - (23%)
Similarity:117/244 - (47%) Gaps:20/244 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASTSRAARSQ-----NAI--PSQEAQQPVDVVDAKVRAILNYILDHTAQKIPIKDKDLIAVAGD 58
            :.|:...|:.|     |:.  ||.......|:::.|...::.::|:...:|.||..:.::.|...
Human    77 LTSSDEGAKGQKGESPNSFHGPSSSESTGRDLLNTKTGELVQFLLNKYIRKEPITREAMLKVINR 141

  Fly    59 KSELKKRLPLV----TNLLAETFGIILTPLDATTKTFICTAEEPVASIHELTPAQR-PQFTLLYI 118
            |  .|:..|.:    |..:...||:.|..:|.:.::::...:....:...|:.... |...||.:
Human   142 K--YKQHFPEILRRSTENVEVVFGLYLKEMDPSRQSYVLVGKLDFPNQGSLSDGGGFPLSGLLMV 204

  Fly   119 ILMYIFLRGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDD 183
            :|..||:.|||..:.:::..|..|.:|...:|..:| ..::.:.:..|::.||  |..|:.:.|.
Human   205 LLSTIFMHGNRATEEEMWECLNALGMYKGRKHFIYG-EPQELVTKDLVREGYL--EYQQVPSSDP 266

  Fly   184 SKTFFLWGPRAKAEFTFEQMVQFASKLLNQHPKVFGHHLSMAQEGVNAE 232
            .:..|||||||:||.:..::::|.:||   :..|...:.|..:|.:..|
Human   267 PRYEFLWGPRARAETSKMKVLEFVAKL---NDTVASTYKSRYEEALREE 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 43/169 (25%)
MAGEB17NP_001264236.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..108 6/30 (20%)
MAGE_N 5..91 CDD:289225 3/13 (23%)
MAGE 116..284 CDD:279759 43/172 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151967
Domainoid 1 1.000 63 1.000 Domainoid score I10231
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5087
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.860

Return to query results.
Submit another query.