DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and MAGEF1

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_071432.2 Gene:MAGEF1 / 64110 HGNCID:29639 Length:307 Species:Homo sapiens


Alignment Length:236 Identity:64/236 - (27%)
Similarity:109/236 - (46%) Gaps:42/236 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASTSRAAR--SQNAIPSQEAQQPVDVVDAKVRAILNYILDHTAQKIPIKDKDLIA-VAGDKSELK 63
            |.|.:.||  :..|:..:.|.:.   ::..|..::.::|....:|.||...:::. |.||   ||
Human    53 ALTRKGARALAAKALARRRAYRR---LNRTVAELVQFLLVKDKKKSPITRSEMVKYVIGD---LK 111

  Fly    64 KRLPLVTNLLAE----TFGIILTPLDATTKTFICTAEEPVASIHELTPAQR----------PQFT 114
            ...|.:....||    .||..|...|....|:|.        |::|.|.:.          |:..
Human   112 ILFPDIIARAAEHLRYVFGFELKQFDRKHHTYIL--------INKLKPLEEEEEEDLGGDGPRLG 168

  Fly   115 LLYIILMYIFLRGNRIEDSKLYVMLEMLNIYPDEEHGYFG-PNLRKQIEETFVKQQYLKRER--- 175
            ||.:||..|::|||...:::::.||..|.:.|.:.|..|| |  ::.|.|.||:|:||...|   
Human   169 LLMMILGLIYMRGNSAREAQVWEMLRRLGVQPSKYHFLFGYP--KRLIMEDFVQQRYLSYRRVPH 231

  Fly   176 SQLSAYDDSKTFFLWGPRAKAEFTFEQMVQFASKLLNQHPK 216
            :....|:     |.||||:..|.:..:::.|.:||..:.|:
Human   232 TNPPEYE-----FSWGPRSNLEISKMEVLGFVAKLHKKEPQ 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 53/183 (29%)
MAGEF1NP_071432.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55 1/1 (100%)
MAGE 83..252 CDD:279759 53/186 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151957
Domainoid 1 1.000 63 1.000 Domainoid score I10231
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5087
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55398
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.