DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Mageb5b

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001192197.1 Gene:Mageb5b / 629542 MGIID:3712084 Length:366 Species:Mus musculus


Alignment Length:204 Identity:54/204 - (26%)
Similarity:89/204 - (43%) Gaps:22/204 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VDAKVRAILNYILDHTAQKIPIKDKDLIAVAGDK-----SELKKR----LPLVTNLLAETFGIIL 81
            :|..|..:..|:|.....|..|....||.:...|     |::.||    :.:|       |...:
Mouse   130 LDMYVNLVEQYVLYKFKMKKLIDRNKLIDLIEPKYRYNFSDIFKRAFENIEIV-------FAASV 187

  Fly    82 TPLDATTKTFICTAEEPVASIHELTPAQ-RPQFTLLYIILMYIFLRGNRIEDSKLYVMLEMLNIY 145
            ..:|:|...:...::..:.:...:.|.: .|:..||..||..||:.|....:..::..|..:.:|
Mouse   188 IEIDSTNHVYDLVSKLKLPNKGRVCPGRGLPKTGLLMTILAMIFMNGTSASEEDIWKFLNYMQVY 252

  Fly   146 PDEEHG-YFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFLWGPRAKAEFTFEQMVQFASK 209
            |..:|. |..|  ||.|.:.|||.:||  |..|:|..|.....|.|||:|..|.|..::::|.:|
Mouse   253 PGRKHFIYREP--RKLITQDFVKLKYL--EYKQISLSDPPCYRFQWGPKAYTETTKMKVLEFMAK 313

  Fly   210 LLNQHPKVF 218
            .....|..|
Mouse   314 GSGVEPSTF 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 48/175 (27%)
Mageb5bNP_001192197.1 MAGE_N 5..>80 CDD:372109
MAGE <219..305 CDD:366651 32/89 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842098
Domainoid 1 1.000 53 1.000 Domainoid score I11275
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I5107
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42492
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.860

Return to query results.
Submit another query.