DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and MAGEE1

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_065983.1 Gene:MAGEE1 / 57692 HGNCID:24934 Length:957 Species:Homo sapiens


Alignment Length:229 Identity:56/229 - (24%)
Similarity:99/229 - (43%) Gaps:41/229 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 STSRAARSQNAIPSQEAQQPVDVVDAKVRAILNYILDHTAQKIPIKDKDLIAVAGDKSELKKRLP 67
            :|||.|.:         .:|.|.::..|..:|.::|.....|.||::.::....  ..|.:.:.|
Human   477 NTSRVAIT---------LKPQDPMEQNVAELLQFLLVKDQSKYPIRESEMREYI--VKEYRNQFP 530

  Fly    68 LVTNLLAE----TFGIILTPLDATTKTFICTAEEPVASIHELTPA---------QRPQFTLLYII 119
            .:....|.    .|...|..||....|:|.        :::|.|.         ..|:..||.:|
Human   531 EILRRAAAHLECIFRFELRELDPEAHTYIL--------LNKLGPVPFEGLEESPNGPKMGLLMMI 587

  Fly   120 LMYIFLRGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDS 184
            |..|||.||:.::::::.||..:.:..:.....|| |.::.:...||.|:||     ......|.
Human   588 LGQIFLNGNQAKEAEIWEMLWRMGVQRERRLSIFG-NPKRLLSVEFVWQRYL-----DYRPVTDC 646

  Fly   185 KTF---FLWGPRAKAEFTFEQMVQFASKLLNQHP 215
            |..   |.||||:..|.|..::::|.:|:.|:.|
Human   647 KPVEYEFFWGPRSHLETTKMKILKFMAKIYNKDP 680

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 44/180 (24%)
MAGEE1NP_065983.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..455
E_Pc_C <143..266 CDD:284226
MAGE 498..666 CDD:279759 45/183 (25%)
Interaction with DTNA. /evidence=ECO:0000250 743..957
MAGE 752..912 CDD:279759
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151961
Domainoid 1 1.000 63 1.000 Domainoid score I10231
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.