DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Tro

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001002272.1 Gene:Tro / 56191 MGIID:1928994 Length:2087 Species:Mus musculus


Alignment Length:220 Identity:61/220 - (27%)
Similarity:108/220 - (49%) Gaps:16/220 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RAARSQNAIP-SQEAQQPVDVVDAKVRA--ILNYILDHTAQKIPIKDKDLI--AVAGDKSELKKR 65
            |...:...|| .:....|.||...:.||  ::.|:|.....|||||..|::  .:...:....:.
Mouse   566 RTGNNYRRIPWGRRLPPPRDVAILQERANKLVKYLLVKDQTKIPIKRSDMLKDVIQEYEDYFPEI 630

  Fly    66 LPLVTNLLAETFGIILTPLDATTKTFI-CTAEEPVASIHELTPAQRPQFTLLYIILMYIFLRGNR 129
            :...:..|.:.|.:.|..:|.....:| .:.:|..|.|.. |....|:..||.:||..||:.||:
Mouse   631 IERASYALEKMFRVNLKEIDKQNNLYILISTQESSAGIMG-TTKDTPKLGLLMVILSVIFMNGNK 694

  Fly   130 IEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRER---SQLSAYDDSKTFFLWG 191
            ..::.::.:|..|.::|..:|..|| .::|.|.:.||||:||:.:|   |:...|:     |.||
Mouse   695 ASEAVIWEVLRKLGLHPGVKHSLFG-EVKKLITDEFVKQKYLEYKRVPNSRPPEYE-----FFWG 753

  Fly   192 PRAKAEFTFEQMVQFASKLLNQHPK 216
            .|:..|.:..::::||.|:..:.||
Mouse   754 LRSYHETSKMKVLKFACKVQKKDPK 778

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 48/170 (28%)
TroNP_001002272.1 Herpes_BLLF1 <20..>243 CDD:282904
COG4372 217..>445 CDD:226809
MAGE 596..756 CDD:396164 46/166 (28%)
ser_rich_anae_1 <869..>1089 CDD:411418
DUF1517 944..>1042 CDD:413074
ser_rich_anae_1 <1222..>1547 CDD:411418
ser_rich_anae_1 1454..>1792 CDD:411418
ser_rich_anae_1 1736..>2064 CDD:411418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842072
Domainoid 1 1.000 53 1.000 Domainoid score I11275
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42492
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11736
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2068
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.