DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and NSMCE3

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_619649.1 Gene:NSMCE3 / 56160 HGNCID:7677 Length:304 Species:Homo sapiens


Alignment Length:219 Identity:70/219 - (31%)
Similarity:114/219 - (52%) Gaps:17/219 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SRAARSQNAIPSQEAQQPVDVVDAKVRAILNYILDHTAQKIPIKDKDLIA-VAGDKS----ELKK 64
            :|.|::..|:..:..:|    ::.||..::.::|....:|||||..|::. |.||..    :|.|
Human    68 ARRAQAAPAVGPRSQKQ----LELKVSELVQFLLIKDQKKIPIKRADILKHVIGDYKDIFPDLFK 128

  Fly    65 RLPLVTNLLAETFGIILTPLDATTKTFI-CTAEEPVASIHELTPAQ-RPQFTLLYIILMYIFLRG 127
            |   ....|...||..|..|:..:.|:| ....|||....|:...| .|...||.|:|..||::|
Human   129 R---AAERLQYVFGYKLVELEPKSNTYILINTLEPVEEDAEMRGDQGTPTTGLLMIVLGLIFMKG 190

  Fly   128 NRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFLWGP 192
            |.|::::.:..|..|.:||.::|..|| :.:|.|.|.||:|:||:..|  :...|.....|.|||
Human   191 NTIKETEAWDFLRRLGVYPTKKHLIFG-DPKKLITEDFVRQRYLEYRR--IPHTDPVDYEFQWGP 252

  Fly   193 RAKAEFTFEQMVQFASKLLNQHPK 216
            |...|.:..::::|.:|:.||.||
Human   253 RTNLETSKMKVLKFVAKVHNQDPK 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 58/171 (34%)
NSMCE3NP_619649.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..82 3/13 (23%)
Interaction with NSMCE1 78..304 67/209 (32%)
MAGE 92..261 CDD:307557 58/174 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 285..304
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I10231
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5087
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55398
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105159
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2068
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.870

Return to query results.
Submit another query.