DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and nsmce3

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_012809679.1 Gene:nsmce3 / 549684 XenbaseID:XB-GENE-1007635 Length:260 Species:Xenopus tropicalis


Alignment Length:243 Identity:77/243 - (31%)
Similarity:117/243 - (48%) Gaps:43/243 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 STSRAARS-QNAIPSQEAQQPVDVVDAKVRAILNYILDHTAQKIPIKDKDLI--AVAGDKS---E 61
            |.|:|.|: ||  .|||.      ::.||..::.|:|....:|:|||..|::  .|...|.   |
 Frog    36 SLSQAQRNLQN--HSQEQ------INLKVGEVVQYLLIKDQKKLPIKRADIVRNVVKEYKDIYPE 92

  Fly    62 LKKRLPLVTNLLAETFGIILTPLDATTKTFICTAEEPVASIHELTPAQRPQ------------FT 114
            :.:|..:.   |.:.||..|..:|..:..:|.|           ...||.|            ..
 Frog    93 IFRRAQIA---LQQVFGFQLEEIDTKSHIYILT-----------NKLQRVQGDGMRVDENTSKLG 143

  Fly   115 LLYIILMYIFLRGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLS 179
            ||.:||..||::||..::|.::.||..|.|.|.|:|..|| :::|.|.|.||||:||  |.|::.
 Frog   144 LLMVILSLIFMKGNTAKESAVWEMLRRLRIEPAEKHSDFG-DVKKLITEEFVKQKYL--EYSKVL 205

  Fly   180 AYDDSKTFFLWGPRAKAEFTFEQMVQFASKLLNQHPKVFGHHLSMAQE 227
            ..|..:..|.||.||..|.:..|:::|.||:..:.||.:......|||
 Frog   206 HTDPVEYEFRWGQRAFKETSKMQVLEFVSKIQQKDPKSWTTQYKDAQE 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 57/181 (31%)
nsmce3XP_012809679.1 MAGE 59..227 CDD:366651 57/184 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I4992
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 1 1.000 - - oto102439
Panther 1 1.100 - - LDO PTHR11736
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2068
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.190

Return to query results.
Submit another query.