DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and MAGEC2

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_057333.1 Gene:MAGEC2 / 51438 HGNCID:13574 Length:373 Species:Homo sapiens


Alignment Length:233 Identity:57/233 - (24%)
Similarity:105/233 - (45%) Gaps:29/233 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASTSRAARSQ--------NAIPSQEAQQPVDVVDAKVRAILNYILDHTAQKIPIKDKDLIAVAGD 58
            :|.|..:.||        ..:|..|:.... .:|.||..::.::|.....:.|:.:.:::.:.  
Human   110 SSFSEESSSQKGEDTGTCQGLPDSESSFTY-TLDEKVAELVEFLLLKYEAEEPVTEAEMLMIV-- 171

  Fly    59 KSELKKRLPLVTNLLAE----TFGIILTPLDATTKTFICTAEEPVASIHELTPAQ-RPQFTLLYI 118
             .:.|...|::.....|    .||:.|..:.   ....|.....|....|.:..: .|:.:||.|
Human   172 -IKYKDYFPVILKRAREFMELLFGLALIEVG---PDHFCVFANTVGLTDEGSDDEGMPENSLLII 232

  Fly   119 ILMYIFLRGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLK-RE--RSQLSA 180
            ||..||::||...:..::.:|..:.:|...||..:| ..|:.:.:.:|:..||: ||  .|....
Human   233 ILSVIFIKGNCASEEVIWEVLNAVGVYAGREHFVYG-EPRELLTKVWVQGHYLEYREVPHSSPPY 296

  Fly   181 YDDSKTFFLWGPRAKAEFTFEQMVQFASKLLNQHPKVF 218
            |:     |||||||.:|...:::::|.:||.|..|..|
Human   297 YE-----FLWGPRAHSESIKKKVLEFLAKLNNTVPSSF 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 42/172 (24%)
MAGEC2NP_057333.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..102
Interaction with TRIM28 135..373 51/208 (25%)
MAGE <229..308 CDD:279759 29/84 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151976
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5087
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.