DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Mageb1l1

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_038956338.1 Gene:Mageb1l1 / 503441 RGDID:1562439 Length:332 Species:Rattus norvegicus


Alignment Length:235 Identity:55/235 - (23%)
Similarity:103/235 - (43%) Gaps:21/235 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SQNAIPSQEAQQPVDVVDAKVRAILNYILDHTAQKIPIKDKDLIAVAGDKSELKKRLPLVTNLLA 74
            |..:.|...::| :|::..|:..::.|:|.....|.|.:..:::.|...:  .|::.|.:....|
  Rat    90 SSCSFPLSGSKQ-IDLLSRKIGMLVEYMLCKYKIKQPARRGEMLKVINKR--FKEQFPDILKKAA 151

  Fly    75 E----TFGIILTPLDATTKTFICTA----EEPVASIHELTPAQRPQFTLLYIILMYIFLRGNRIE 131
            .    .||:.:..:....:|:|..:    ::..:...||..   |...:|..:|..|:|......
  Rat   152 HRLDVVFGLEVKEVQPHGQTYILVSKLEFQDDGSESSELGV---PTRGILIPLLSVIYLNNYCAP 213

  Fly   132 DSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFLWGPRAKA 196
            :.:::..|.||.:|....|..|| |.||.|.|..|:::||  |..::...|.....||||.:|.|
  Rat   214 EKEVWHFLNMLGVYDGVPHIIFG-NTRKLITEDLVQEEYL--EYREVPDSDPPSYQFLWGSKAYA 275

  Fly   197 EFTFEQMVQFASKLLNQHPKVFGHHLSMA----QEGVNAE 232
            |.:..:::.|..|:....|..:......|    :|...||
  Rat   276 ESSKRKVMDFLGKVSETMPSSYSFRCEQALIEEEEKAEAE 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 43/172 (25%)
Mageb1l1XP_038956338.1 MAGE_N 5..88 CDD:403589
MAGE 112..280 CDD:396164 43/175 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.