DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and NDN

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_002478.1 Gene:NDN / 4692 HGNCID:7675 Length:321 Species:Homo sapiens


Alignment Length:234 Identity:62/234 - (26%)
Similarity:108/234 - (46%) Gaps:8/234 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASTSRAARSQNAI-PSQEAQQPVDVVDAKVRAILNYILDHTAQKIPIKDKDLI--AVAGDKSELK 63
            |...||.::.:|. |......|..:|. |...::.|:|....:|:.|...|::  .:...|...:
Human    74 AEEGRAHQAPSAAQPGPAPPAPAQLVQ-KAHELMWYVLVKDQKKMIIWFPDMVKDVIGSYKKWCR 137

  Fly    64 KRLPLVTNLLAETFGIILTPLDATTKTF-ICTAEEPVASIHELTPAQRPQFTLLYIILMYIFLRG 127
            ..|...:.:||..||:.|......|..| :..|.||..........:.|...||.:||..|:::|
Human   138 SILRRTSLILARVFGLHLRLTSLHTMEFALVKALEPEELDRVALSNRMPMTGLLLMILSLIYVKG 202

  Fly   128 NRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFLWGP 192
            ....:|.::.:|.:|.:.|.::|..|| ::||.|.|.||:..|||.:|  :...:..:..|.||.
Human   203 RGARESAVWNVLRILGLRPWKKHSTFG-DVRKLITEEFVQMNYLKYQR--VPYVEPPEYEFFWGS 264

  Fly   193 RAKAEFTFEQMVQFASKLLNQHPKVFGHHLSMAQEGVNA 231
            ||..|.|..|:::|.:::..:.|:.:......|.|...|
Human   265 RASREITKMQIMEFLARVFKKDPQAWPSRYREALEEARA 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 48/167 (29%)
NDNNP_002478.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..96 5/21 (24%)
MAGE 105..273 CDD:396164 48/170 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151955
Domainoid 1 1.000 63 1.000 Domainoid score I10231
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5087
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55398
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
88.010

Return to query results.
Submit another query.