DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Mageb4

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001028664.2 Gene:Mageb4 / 434903 MGIID:2148568 Length:556 Species:Mus musculus


Alignment Length:243 Identity:64/243 - (26%)
Similarity:111/243 - (45%) Gaps:20/243 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TSRAARSQNA----IPSQEAQQPVDVVDAKVRAILNYILDHTAQKIPIKDKDLIAVAGDKSELKK 64
            ::|..|.::.    :|........|::..|...::.|:|.....|.|....:::.|...:  .|:
Mouse    85 STRGPREESTSCTRVPRFSENPQNDLLTRKTGMLMQYLLCKYKMKQPASKGEMLKVINRR--FKE 147

  Fly    65 RLPLVTNLLAE----TFGIILTPLDATTKTFICTAE-EPVASIHELTPAQRPQFTLLYIILMYIF 124
            :||.:....:|    .||:.:..:......:...:: :|.......|....||..||..:|..||
Mouse   148 QLPEILKKASERIQLVFGLEVKEIKPNGGYYTLVSKLDPSVGNALTTSLPFPQNGLLMPLLGVIF 212

  Fly   125 LRGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTF-F 188
            |.|||..:::::..|.:|.||..:.|..|| ..||.|....||::||..::   .|..|..:| |
Mouse   213 LNGNRASEAEIWEFLNVLGIYDGKVHIIFG-EPRKLITRDLVKEKYLVYQK---EANSDPPSFEF 273

  Fly   189 LWGPRAKAEFTFEQMVQFASKLLNQHPKVFGHHLSMA----QEGVNAE 232
            ||||||.||.|..::::|.:::....|:.|..|...|    :|...||
Mouse   274 LWGPRAYAETTKMKILEFLAEVNETVPQAFPTHYEEALRDQEERAQAE 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 51/170 (30%)
Mageb4NP_001028664.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..110 3/24 (13%)
MAGE_N 5..93 CDD:289225 2/7 (29%)
MAGE 118..286 CDD:279759 51/173 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 315..335 3/7 (43%)
15 X 15 AA approximate tandem repeats. /evidence=ECO:0000303|PubMed:10706124 334..554
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842071
Domainoid 1 1.000 53 1.000 Domainoid score I11275
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 1 1.000 - - otm42492
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.810

Return to query results.
Submit another query.