DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and MAGEB2

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_002355.2 Gene:MAGEB2 / 4113 HGNCID:6809 Length:319 Species:Homo sapiens


Alignment Length:234 Identity:66/234 - (28%)
Similarity:113/234 - (48%) Gaps:27/234 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASTSRAARSQNAIPSQEAQQPVDVVDAKVRAILNYILDHTAQKIPIKDKDLIAVAGDKSELKKRL 66
            ||:|:|:.|..: ||:      |.:..|..:::.::|.....|..:...:::.:.|.:  .::..
Human    94 ASSSQASTSTKS-PSE------DPLTRKSGSLVQFLLYKYKIKKSVTKGEMLKIVGKR--FREHF 149

  Fly    67 PLVTNLLAE----TFGIILTPLDAT--TKTFI----CTAEEPVASIHELTPAQRPQFTLLYIILM 121
            |.:....:|    .||:.|..::..  |.|||    .|.||.:.|..:.     |:..||..:|.
Human   150 PEILKKASEGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDF-----PRRKLLMPLLG 209

  Fly   122 YIFLRGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKT 186
            .|||.||...:.:::..|.||.:|..|||..||... |.|.:..|:::||  |..|:.:.|..:.
Human   210 VIFLNGNSATEEEIWEFLNMLGVYDGEEHSVFGEPW-KLITKDLVQEKYL--EYKQVPSSDPPRF 271

  Fly   187 FFLWGPRAKAEFTFEQMVQFASKLLNQHPKVFGHHLSMA 225
            .|||||||.||.:..::::|.:|:....|..|..|...|
Human   272 QFLWGPRAYAETSKMKVLEFLAKVNGTTPCAFPTHYEEA 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 51/174 (29%)
MAGEB2NP_002355.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..112 8/24 (33%)
MAGE_N 5..93 CDD:289225
MAGE 139..286 CDD:279759 49/156 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151951
Domainoid 1 1.000 63 1.000 Domainoid score I10231
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5087
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.860

Return to query results.
Submit another query.