DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and MAGEB1

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_002354.2 Gene:MAGEB1 / 4112 HGNCID:6808 Length:347 Species:Homo sapiens


Alignment Length:234 Identity:65/234 - (27%)
Similarity:111/234 - (47%) Gaps:27/234 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASTSRAARSQNAIPSQEAQQPVDVVDAKVRAILNYILDHTAQKIPIKDKDLIAVAGDK-----SE 61
            ||.|:|..|..:       ...|.|..:...::::||.....:.||...|::.|..:|     :|
Human    91 ASFSQATTSTES-------SVKDPVAWEAGMLMHFILRKYKMREPIMKADMLKVVDEKYKDHFTE 148

  Fly    62 L----KKRLPLVTNLLAETFGIILTPLDATTKTFICTAEEPVASIHELT-PAQRPQFTLLYIILM 121
            :    .:||.||       ||:.|...:.:..|:...::..:.:...|: ....|:..||..:|.
Human   149 ILNGASRRLELV-------FGLDLKEDNPSGHTYTLVSKLNLTNDGNLSNDWDFPRNGLLMPLLG 206

  Fly   122 YIFLRGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKT 186
            .|||:||...:.:::..:.:|..|..|||..:| ..||.|.:..|:::|||.|  |:...|..:.
Human   207 VIFLKGNSATEEEIWKFMNVLGAYDGEEHLIYG-EPRKFITQDLVQEKYLKYE--QVPNSDPPRY 268

  Fly   187 FFLWGPRAKAEFTFEQMVQFASKLLNQHPKVFGHHLSMA 225
            .|||||||.||.|..::::|.:|:....|:.|..|...|
Human   269 QFLWGPRAYAETTKMKVLEFLAKMNGATPRDFPSHYEEA 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 52/174 (30%)
MAGEB1NP_002354.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..104 5/19 (26%)
MAGE_N 5..90 CDD:289225
MAGE 115..283 CDD:279759 52/177 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 315..347
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151959
Domainoid 1 1.000 63 1.000 Domainoid score I10231
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5087
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.860

Return to query results.
Submit another query.