DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and MAGEA8

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001159872.1 Gene:MAGEA8 / 4107 HGNCID:6806 Length:318 Species:Homo sapiens


Alignment Length:215 Identity:48/215 - (22%)
Similarity:99/215 - (46%) Gaps:20/215 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DVVDAKVRAILNYILDHTAQKIPIKDKDLI--AVAGDKSELKKRLPLVTNLLAETFGIILTPLDA 86
            :.:|.||..::.::|.....|.|:...:::  .:...|:.........:..:...|||.:..:|.
Human   110 EALDEKVAELVRFLLRKYQIKEPVTKAEMLESVIKNYKNHFPDIFSKASECMQVIFGIDVKEVDP 174

  Fly    87 TTKTFICT-----AEEPVASIHELTPAQRPQFTLLYIILMYIFLRGNRIEDSKLYVMLEMLNIYP 146
            ...::|..     :.:.:....:.|    |:..||.|:|..|.:.|:|..:..::..|.::.:|.
Human   175 AGHSYILVTCLGLSYDGLLGDDQST----PKTGLLIIVLGMILMEGSRAPEEAIWEALSVMGLYD 235

  Fly   147 DEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFLWGPRAKAEFTF----EQMVQFA 207
            ..||..:. .|||.:.:.:|::.||  |..|....|..:..|||||||.||.::    |.:|:..
Human   236 GREHSVYW-KLRKLLTQEWVQENYL--EYRQAPGSDPVRYEFLWGPRALAETSYVKVLEHVVRVN 297

  Fly   208 SKLLNQHPKVFGHHLSMAQE 227
            :::...:|.:  |..::.:|
Human   298 ARVRISYPSL--HEEALGEE 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 40/175 (23%)
MAGEA8NP_001159872.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..103
MAGE_N 5..94 CDD:315167
MAGE 119..283 CDD:307557 38/170 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151964
Domainoid 1 1.000 63 1.000 Domainoid score I10231
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5087
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.