DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and MAGEA4

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001011548.1 Gene:MAGEA4 / 4103 HGNCID:6802 Length:317 Species:Homo sapiens


Alignment Length:239 Identity:57/239 - (23%)
Similarity:115/239 - (48%) Gaps:36/239 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SQEAQQPVDVVDAK--VRAILNYILDHTAQKI--PIKDKDLIAVAGDKSELKKRL--------PL 68
            |||.:.|....||:  .|..|:..:|..|..:  ..:.|:|:.    |:|:.:|:        |:
Human    90 SQEEEGPSTSPDAESLFREALSNKVDELAHFLLRKYRAKELVT----KAEMLERVIKNYKRCFPV 150

  Fly    69 VTNLLAET----FGIILTPLDATTKTF-----ICTAEEPVASIHELTPAQRPQFTLLYIILMYIF 124
            :....:|:    |||.:..:|..:.|:     :..:.:.:...:::.    |:..||.|:|..|.
Human   151 IFGKASESLKMIFGIDVKEVDPASNTYTLVTCLGLSYDGLLGNNQIF----PKTGLLIIVLGTIA 211

  Fly   125 LRGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFL 189
            :.|:...:.:::..|.::.:|...||..:| ..||.:.:.:|::.||  |..|:...:.::..||
Human   212 MEGDSASEEEIWEELGVMGVYDGREHTVYG-EPRKLLTQDWVQENYL--EYRQVPGSNPARYEFL 273

  Fly   190 WGPRAKAEFTF----EQMVQFASKLLNQHPKVFGHHLSMAQEGV 229
            |||||.||.::    |.:|:..:::...:|.:....|...:|||
Human   274 WGPRALAETSYVKVLEHVVRVNARVRIAYPSLREAALLEEEEGV 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 42/187 (22%)
MAGEA4NP_001011548.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..102 4/11 (36%)
MAGE_N 5..95 CDD:403589 3/4 (75%)
MAGE 131..281 CDD:396164 36/160 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151956
Domainoid 1 1.000 63 1.000 Domainoid score I10231
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5087
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.