DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and MAGEA3

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_005353.1 Gene:MAGEA3 / 4102 HGNCID:6801 Length:314 Species:Homo sapiens


Alignment Length:235 Identity:52/235 - (22%)
Similarity:104/235 - (44%) Gaps:35/235 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 STSRAARSQNAIPSQEAQQPVDVVDAKVRAILNYILDHTAQKIPIKDKDLI-AVAGD-------- 58
            |:::.....:..|..|::... .:..||..:::::|.....:.|:...::: :|.|:        
Human    87 SSNQEEEGPSTFPDLESEFQA-ALSRKVAELVHFLLLKYRAREPVTKAEMLGSVVGNWQYFFPVI 150

  Fly    59 KSELKKRLPLVTNLLAETFGIILTPLDATTKTFI---C--TAEEPVASIHELTPAQRPQFTLLYI 118
            .|:....|.||       |||.|..:|.....:|   |  .:.:.:...:::    .|:..||.|
Human   151 FSKASSSLQLV-------FGIELMEVDPIGHLYIFATCLGLSYDGLLGDNQI----MPKAGLLII 204

  Fly   119 ILMYIFLRGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDD 183
            :|..|...|:...:.|::..|.:|.::...|....| :.:|.:.:.||::.||  |..|:...|.
Human   205 VLAIIAREGDCAPEEKIWEELSVLEVFEGREDSILG-DPKKLLTQHFVQENYL--EYRQVPGSDP 266

  Fly   184 SKTFFLWGPRAKAEFTFEQMVQFASKLLNQHPKVFGHHLS 223
            :...|||||||..|.::.:::....|:..      |.|:|
Human   267 ACYEFLWGPRALVETSYVKVLHHMVKISG------GPHIS 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 43/178 (24%)
MAGEA3NP_005353.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..99 1/11 (9%)
MAGE_N 5..94 CDD:289225 1/6 (17%)
MAGE 116..280 CDD:279759 42/177 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151962
Domainoid 1 1.000 63 1.000 Domainoid score I10231
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5087
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.