DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and ndnl2

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001269018.1 Gene:ndnl2 / 386658 ZFINID:ZDB-GENE-031107-3 Length:260 Species:Danio rerio


Alignment Length:221 Identity:61/221 - (27%)
Similarity:115/221 - (52%) Gaps:21/221 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 STSRAARSQNAIPSQEAQQPVDVVDAKVRAILNYILDHTAQKIPIKDKDL--IAVAGDKSELKKR 65
            ::|:|.|::....|       |.:|.||..::.:||....:||||:..|:  ..:...|....:.
Zfish    35 TSSQAQRARENFTS-------DQIDHKVAEVVQFILIKDQKKIPIRRADIGKHVIKDYKHIYAEV 92

  Fly    66 LPLVTNLLAETFGIILTPLDATTKTFICTAE-EPV----ASIHELTPAQRPQFTLLYIILMYIFL 125
            :..|.....:.||:.|..:|.....:|...: ||:    .|:|   |. .|:..||::||..||:
Zfish    93 MNRVCRTFEQVFGLKLVEIDLKQHIYILINKLEPIRGQTVSMH---PG-NPKMGLLFVILSVIFM 153

  Fly   126 RGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFLW 190
            :|..|:::.::..|:.|.:.|.|:|..|| :::|.:.|.||:|:||  |..::...:..:..|.|
Zfish   154 KGGTIKENLVWNTLKKLRLDPGEKHDEFG-DVKKVVTEEFVRQKYL--EYGKIPHTEPVEYEFRW 215

  Fly   191 GPRAKAEFTFEQMVQFASKLLNQHPK 216
            |.||:.|.:..::::|..:|.:|.|:
Zfish   216 GLRAEKEVSKLKLLEFVGELFDQDPQ 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 49/171 (29%)
ndnl2NP_001269018.1 MAGE 58..225 CDD:279759 49/173 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596630
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I5198
OMA 1 1.010 - - QHG55398
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 1 1.000 - - oto39395
orthoMCL 1 0.900 - - OOG6_105159
Panther 1 1.100 - - LDO PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.770

Return to query results.
Submit another query.