DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and MAGEB5

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001258681.1 Gene:MAGEB5 / 347541 HGNCID:23795 Length:275 Species:Homo sapiens


Alignment Length:231 Identity:54/231 - (23%)
Similarity:104/231 - (45%) Gaps:20/231 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SQNAIPSQEAQQPVDVVDAKVRAILNYILDHTAQKIPIKDKDLIAVAGDK-----SELKKRLPLV 69
            |....||.|:... :.::.||..:..::|.....|..|..:|::.:...:     :|:.:|   .
Human    25 SSEVSPSTESSCS-NFINIKVGLLEQFLLYKFKMKQRILKEDMLKIVNPRYQNQFAEIHRR---A 85

  Fly    70 TNLLAETFGIILTPLDATTKTFICTAEEPVAS---IHELTPAQRPQFTLLYIILMYIFLRGNRIE 131
            :..:...|.:.|..::.|...:...::..:.:   ||  .....|:..||...|:.|||:||...
Human    86 SEHIEVVFAVDLKEVNPTCHLYDLVSKLKLPNNGRIH--VGKVLPKTGLLMTFLVVIFLKGNCAN 148

  Fly   132 DSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFLWGPRAKA 196
            ....:..|:|:.||..:::..:| ..||.|.:.||:..||  |..|:.....:...|||||||..
Human   149 KEDTWKFLDMMQIYDGKKYYIYG-EPRKLITQDFVRLTYL--EYHQVPCSYPAHYQFLWGPRAYT 210

  Fly   197 EFTFEQMVQFASKLLNQHPKVFGHHLSMAQEGVNAE 232
            |.:..:::::.:|:.:..|..|.   |..:|.:..|
Human   211 ETSKMKVLEYLAKVNDIAPGAFS---SQYEEALQDE 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 42/172 (24%)
MAGEB5NP_001258681.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33 3/7 (43%)
MAGE 61..215 CDD:279759 40/161 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151981
Domainoid 1 1.000 63 1.000 Domainoid score I10231
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5087
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.