DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Magec2

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001020884.1 Gene:Magec2 / 317590 RGDID:1563272 Length:429 Species:Rattus norvegicus


Alignment Length:207 Identity:52/207 - (25%)
Similarity:94/207 - (45%) Gaps:26/207 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VVDAKVRAILNYILDHTAQKIPIKDKDLIAVAGDKSELKKRLPLV----TNLLAETFGIILTPLD 85
            ::..|...::...:.....|.||...::..|.  ..|.:...|::    :..|..||||.:...|
  Rat   203 IIQEKATDLVFLFIYKYRMKEPITLSEIHEVV--TKEYENHFPVIFTEASKCLEMTFGIDIKESD 265

  Fly    86 ATTKTFI------CTAEEPVASIHELTPAQRPQFTLLYIILMYIFLRGNRIEDSKLYVMLEMLNI 144
            ..:..::      .|.|:.:.....|     |:...|.:||..||:.||...:.:::..|:::.:
  Rat   266 LLSSAYVFVNSLNLTYEDVLGDTDRL-----PRNAFLIVILGVIFIEGNCASEERIWEFLKLVGV 325

  Fly   145 YPDEEHGYFGPNLRKQIEETFVKQQYLK-RE--RSQLSAYDDSKTFFLWGPRAKAEFTFEQMVQF 206
            |..|||...| :.|:.:....|:|.||: ||  .:|...::     |||||||.||.|..::::|
  Rat   326 YDGEEHFICG-DPREFLTTHLVQQNYLEYREVPNTQPPCFE-----FLWGPRAYAETTKMKVLEF 384

  Fly   207 ASKLLNQHPKVF 218
            .:|:....|..|
  Rat   385 LAKMNGCDPSDF 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 47/177 (27%)
Magec2NP_001020884.1 MAGE 224..379 CDD:279759 46/167 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345474
Domainoid 1 1.000 55 1.000 Domainoid score I10828
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5077
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44556
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.