DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and MGC114492

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001020066.1 Gene:MGC114492 / 317324 RGDID:1561901 Length:300 Species:Rattus norvegicus


Alignment Length:242 Identity:62/242 - (25%)
Similarity:107/242 - (44%) Gaps:44/242 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SRAARSQNAIPSQEAQ-QPV-----------DVVDAKV-RAILNYILDHTAQKIPIKDKDLIAVA 56
            |.|..|...:||..|. .||           |::::|| ..||..:|.:..::...|.:.|..|.
  Rat    60 SAAINSPAEVPSVGAPGGPVGEAFGPDSSRQDMLNSKVIDLILFLLLKYRRKQQTCKAEILYMVI 124

  Fly    57 GDKSELKKRLPLV----TNLLAETFGIILTPLDATTKTFICTAEEPVASIHEL----------TP 107
            ....|   ..|::    ::.|..|||:.:...:....::        :.:|.|          .|
  Rat   125 RGYEE---HFPVIFAKASDCLRLTFGLEIVERNPRVHSY--------SLVHALGLTYDGMQHGFP 178

  Fly   108 AQRPQFTLLYIILMYIFLRGNRIEDSKLYVMLEMLNIYPDEEHGYFG-PNLRKQIEETFVKQQYL 171
            .. |:..||.|:|..||:..|...:..|:.:|..:.:|...:|..:| |.:  .|.|.||::.||
  Rat   179 GV-PKTGLLIIVLCIIFIEDNCASEQVLWRILNNVGLYAGRDHFVYGDPGV--LITEHFVQEGYL 240

  Fly   172 KRERSQLSAYDDSKTFFLWGPRAKAEFTFEQMVQFASKLLNQHPKVF 218
              |..|::..|.....:||||||.||.|..::::|.:.::.|.||.:
  Rat   241 --ECRQVADSDPPTKEYLWGPRAHAETTKMKLLKFFASIVKQDPKSY 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 45/179 (25%)
MGC114492NP_001020066.1 MAGE 130..268 CDD:279759 40/150 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345480
Domainoid 1 1.000 55 1.000 Domainoid score I10828
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5077
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44556
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.900

Return to query results.
Submit another query.