DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Magea9

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001020064.1 Gene:Magea9 / 317297 RGDID:1565494 Length:300 Species:Rattus norvegicus


Alignment Length:108 Identity:33/108 - (30%)
Similarity:59/108 - (54%) Gaps:3/108 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 PQFTLLYIILMYIFLRGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRER 175
            |:..|:.|:|..||:..|.:.:...:.::..|.:|...:|..|| :.|..|.|.||::.|:  |.
  Rat   181 PKTGLVIIVLCIIFIEDNCVSEEVFWHVMNSLGMYAGVDHFIFG-DPRSLITEDFVQEGYV--EY 242

  Fly   176 SQLSAYDDSKTFFLWGPRAKAEFTFEQMVQFASKLLNQHPKVF 218
            .|:......:..|||||||.||.|..::::|.:.::.|.|:.:
  Rat   243 RQVPNSHPPRFEFLWGPRAYAETTKMKILEFYASIVRQDPRSY 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 30/89 (34%)
Magea9NP_001020064.1 MAGE_N 17..>67 CDD:403589
MAGE <182..268 CDD:396164 29/88 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345476
Domainoid 1 1.000 55 1.000 Domainoid score I10828
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5077
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 1 1.000 - - otm44556
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.