DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Mageb16

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001020184.1 Gene:Mageb16 / 317274 RGDID:1562365 Length:360 Species:Rattus norvegicus


Alignment Length:239 Identity:58/239 - (24%)
Similarity:109/239 - (45%) Gaps:38/239 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 STSRAAR--------SQNAIPSQEAQQPVDVVDAKVRAILNYIL--DHTAQKIPIKDKDLIAVAG 57
            |:|.:|:        ..:.||..:...||..:|.||..::||:|  ....:.:.:.|...:.|..
  Rat    94 SSSESAKGLGNKEMQGNSVIPPDQPDLPVMTIDGKVNFLVNYMLYKYQVKEMMSMNDIMTLIVRE 158

  Fly    58 DKSELKKRLPLVTNLLAETFGIILTPLDATTKTFICTAEEPVASIHEL-------------TPAQ 109
            |:....:.|...:..:...||:.:..:|            ||...:.|             ....
  Rat   159 DEHHFHEILMRASERMEMVFGLEVREVD------------PVNHFYALFIKLGLTYDGMRADEYS 211

  Fly   110 RPQFTLLYIILMYIFLRGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRE 174
            .|:..||.:||..:|::|||..:.:::.:|..:.||....|..|| :.|:.:.:.||::|||..:
  Rat   212 FPKTGLLILILGVVFMKGNRATEEEIWEVLNPMGIYAGMNHFIFG-DPRELLTDDFVREQYLAYQ 275

  Fly   175 RSQLSAYDDSKTFFLWGPRAKAEFTFEQMVQFASKLLNQHPKVF 218
              .::..|..:..::||||||||.:..::::|.:|:....|.||
  Rat   276 --PIANSDPIQYEYVWGPRAKAETSKMKVLEFVAKVHGSDPTVF 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 42/179 (23%)
Mageb16NP_001020184.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..118 5/23 (22%)
MAGE_N 3..>99 CDD:403589 2/4 (50%)
MAGE 150..300 CDD:396164 40/164 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 340..360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345494
Domainoid 1 1.000 55 1.000 Domainoid score I10828
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5077
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 1 1.000 - - otm44556
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.