DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Mageb4

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_038955675.1 Gene:Mageb4 / 317271 RGDID:1561997 Length:342 Species:Rattus norvegicus


Alignment Length:212 Identity:55/212 - (25%)
Similarity:101/212 - (47%) Gaps:21/212 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DVVDAKVRAILNYILDHTAQKIPIKDKDLIAVAGDK-----SELKKRLPLVTNLLAETFGIILTP 83
            |.:..|...::.::||....|..:...:::||...|     ||:.:|......|:   ||:.|..
  Rat   125 DPIMRKASVLIEFLLDKFKMKEAVTKSEMLAVVNKKYKEHFSEILRRTSARLELV---FGLELKE 186

  Fly    84 LDATTKTFICTAEEPVASIHELTPA-QRPQFTLLYIILMYIFLRGNRIEDSKLYVMLEMLNIYPD 147
            :||:|::::...:..:::...|:.. ..|:..||..||..||::|||....:::..|..:.:|..
  Rat   187 IDASTQSYLLVGKLGLSTEGSLSSNWGLPKTGLLMSILGVIFMKGNRATVQEVWQFLNGVGVYAG 251

  Fly   148 EEHGYFGPNLRKQIEETF----VKQQYLKRERSQLSAYDDSKTFFLWGPRAKAEFTFEQMVQFAS 208
            ::|..||.      .|.|    |::.||...  |:.:.|.....|||||||.||.|..::::..:
  Rat   252 KKHLIFGE------PEAFITDLVQENYLAYR--QVPSSDPPSYEFLWGPRAHAETTKMKVLEVLA 308

  Fly   209 KLLNQHPKVFGHHLSMA 225
            |:....|..|.:...:|
  Rat   309 KVNGTVPSAFPNLYQLA 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 49/174 (28%)
Mageb4XP_038955675.1 MAGE_N 31..100 CDD:403589
MAGE 156..301 CDD:396164 45/155 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345492
Domainoid 1 1.000 55 1.000 Domainoid score I10828
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5077
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 1 1.000 - - otm44556
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.860

Return to query results.
Submit another query.