DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Mageb18

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001037711.1 Gene:Mageb18 / 317270 RGDID:1560369 Length:325 Species:Rattus norvegicus


Alignment Length:208 Identity:48/208 - (23%)
Similarity:97/208 - (46%) Gaps:27/208 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DVVDAKVRAILNYILDHTAQKIPIKDKDLI--AVAGDKSELKKRLPLVTNLLAETFGIILTPLDA 86
            |.::.||..::.::::...:|..|...|::  .:...|:...:.|...:..:...||:.|..:|.
  Rat    89 DPINHKVVLLVQFLIEKYQKKEVITKADMLKSVIKTSKNHFNEILKRASEHMELAFGVDLKEVDP 153

  Fly    87 TTKTFI-----------CTAEEPVASIHELTPAQRPQFTLLYIILMYIFLRGNRIEDSKLYVMLE 140
            ....:.           ...||.|           |...||.|:|..||::.|...:::::.:|.
  Rat   154 NRHCYALFNKLEHTFDGVMGEEKV-----------PNSGLLMIVLGVIFMKDNCPPETEIWNVLS 207

  Fly   141 MLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFLWGPRAKAEFTFEQMVQ 205
            |:.:|.:.:|..:| :.:|.|.|..|:.:||  |..|:...:.....|:|||||:||.:..::::
  Rat   208 MMGVYANRKHFIYG-DPKKVITEDMVQLKYL--EYRQVPNSNPPSFEFMWGPRARAEISKMKILE 269

  Fly   206 FASKLLNQHPKVF 218
            |.:|:.:..|..|
  Rat   270 FWAKIHDTTPDSF 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 41/177 (23%)
Mageb18NP_001037711.1 MAGE_N 5..76 CDD:289225
MAGE 98..265 CDD:279759 41/180 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345487
Domainoid 1 1.000 55 1.000 Domainoid score I10828
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5077
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 1 1.000 - - otm44556
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.